• THAT   AND
  • THAT   AND


Mus musculus interferon alpha 1 (Ifna1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_010502 Mus musculus interferon alpha 1 (Ifna1), mRNA. Full Lenth $165.30
ORF Sequence $165.30
RefSeq Version NM_010502.2, 117168292
Length 570 bp
Structure linear
Update Date 23-JAN-2011
Organism Mus musculus (house mouse)
Definition Mus musculus interferon alpha 1 (Ifna1), mRNA.
Product interferon alpha-1 precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BX530016.11. On Nov 1, 2006 this sequence version replaced gi:6754289.

RefSeq NP_034632.2
CDS 1..570
Exon (1)1..570
Translation MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG FPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQ GCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN VLGRLREEK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+c, tdbSNP:28107269
125+c, tdbSNP:28093074
186+c, gdbSNP:46108518
214+a, cdbSNP:28093073
266+a, cdbSNP:48585693
268+a, cdbSNP:46315697
274+a, tdbSNP:47515454
297+a, tdbSNP:49940875
304+a, gdbSNP:28093072
333+a, cdbSNP:51388539
339+c, tdbSNP:28093071
414+c, tdbSNP:28093070
Gene SymbolIfna1
Gene SynonymIfa1
Chromosome4
Locus Map4 42.6 cM
All Transcripts NM_010502
Title Type I IFN enhances follicular B cell contribution to the T cell-independent antibody response .
Author Swanson,C.L., Wilson,T.J., Strauch,P., Colonna,M., Pelanda,R. and Torres,R.M.
Journal J. Exp. Med. 207 (7), 1485-1500 (2010)
Title Murine coronavirus induces type I interferon in oligodendrocytes through recognition by RIG-I and MDA5 .
Author Li,J., Liu,Y. and Zhang,X.
Journal J. Virol. 84 (13), 6472-6482 (2010)
Title Interferon-alpha/beta genes are up-regulated in murine brain astrocytes after infection with Theiler's murine encephalomyelitis virus .
Author Rubio,N., Palomo,M. and Alcami,A.
Journal J. Interferon Cytokine Res. 30 (4), 253-262 (2010)
Title Plasmacytoid dendritic cell-derived type I interferon is crucial for the adjuvant activity of Toll-like receptor 7 agonists .
Author Rajagopal,D., Paturel,C., Morel,Y., Uematsu,S., Akira,S. and Diebold,S.S.
Journal Blood 115 (10), 1949-1957 (2010)
Title Regulation of inflammatory monocyte/macrophage recruitment from the bone marrow during murine cytomegalovirus infection: role for type .
Author Crane,M.J., Hokeness-Antonelli,K.L. and Salazar-Mather,T.P.
Journal J. Immunol. 183 (4), 2810-2817 (2009)
Title Behavioral effects of mouse interferons-alpha and -gamma and human interferon-alpha in mice .
Author Crnic,L.S. and Segall,M.A.
Journal Brain Res. 590 (1-2), 277-284 (1992)
Title Cytokine gene regulation: regulatory cis-elements and DNA binding factors involved in the interferon system .
Author Tanaka,N. and Taniguchi,T.
Journal Adv. Immunol. 52, 263-281 (1992)
Title The physical separation of Lps and Ifa loci in BXH recombinant inbred mice .
Author Fultz,M.J. and Vogel,S.N.
Journal J. Immunol. 143 (9), 3001-3006 (1989)
Title Characterization of a mouse interferon gene locus I. Isolation of a cluster of four alpha interferon genes .
Author Kelley,K.A. and Pitha,P.M.
Journal Nucleic Acids Res. 13 (3), 805-823 (1985)
Title Organization, structure and expression of murine interferon alpha genes .
Author Zwarthoff,E.C., Mooren,A.T. and Trapman,J.
Journal Nucleic Acids Res. 13 (3), 791-804 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878