• THAT   AND
  • THAT   AND


Mus musculus myelin oligodendrocyte glycoprotein (Mog), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_010814 Mus musculus myelin oligodendrocyte glycoprotein (Mog), mRNA. Full Lenth $500.25
ORF Sequence $215.76
RefSeq Version NM_010814.2, 113199770
Length 1725 bp
Structure linear
Update Date 23-APR-2011
Organism Mus musculus (house mouse)
Definition Mus musculus myelin oligodendrocyte glycoprotein (Mog), mRNA.
Product myelin-oligodendrocyte glycoprotein
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BY127313.1, BC080860.1, CR956641.9 and CD776673.1. On Aug 25, 2006 this sequence version replaced gi:6754719.

RefSeq NP_034944.2
CDS 200..943
Exon (1)1..287
Exon (2)1..287
Exon (3)288..635
Exon (4)636..749
Exon (5)750..770
Exon (6)771..791
Exon (7)792..908
Exon (8)909..929
Exon (9)930..1707
Translation MACLWSFSWPSCFLSLLLLLLLQLSCSYAGQFRVIGPGYPIRALVGDEAELPCRISPGKN ATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFS DEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLTLIALVPTILLQVSVGLVFLFLQH RLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL EELRNPF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1049)-g, adbSNP:49815201
complement(1461)-g, adbSNP:49071123
Gene SymbolMog
Gene SynonymB230317G11Rik
Chromosome17
Locus Map17 20.34 cM
All Transcripts NM_010814
Title Antigen-specific splenic CD4+ and CD8+ regulatory T cells generated via the eye, suppress experimental autoimmune encephalomyelitis either at the priming or at the effector phase .
Author Bhowmick,S., Clark,R.B., Brocke,S. and Cone,R.E.
Journal Int. Immunol. 23 (2), 119-128 (2011)
Title Rheb1 is required for mTORC1 and myelination in postnatal brain development .
Author Zou,J., Zhou,L., Du,X.X., Ji,Y., Xu,J., Tian,J., Jiang,W., Zou,Y., Yu,S., Gan,L., Luo,M., Yang,Q., Cui,Y., Yang,W., Xia,X., Chen,M., Zhao,X., Shen,Y., Chen,P.Y., Worley,P.F. and Xiao,B.
Journal Dev. Cell 20 (1), 97-108 (2011)
Title Oligodendrocyte-specific FADD deletion protects mice from autoimmune-mediated demyelination .
Author Mc Guire,C., Volckaert,T., Wolke,U., Sze,M., de Rycke,R., Waisman,A., Prinz,M., Beyaert,R., Pasparakis,M. and van Loo,G.
Journal J. Immunol. 185 (12), 7646-7653 (2010)
Title CNS/PNS boundary transgression by central glia in the absence of Schwann cells or Krox20/Egr2 function .
Author Coulpier,F., Decker,L., Funalot,B., Vallat,J.M., Garcia-Bragado,F., Charnay,P. and Topilko,P.
Journal J. Neurosci. 30 (17), 5958-5967 (2010)
Title Contribution of myelin autoantigen citrullination to T cell autoaggression in the central nervous system .
Author Carrillo-Vico,A., Leech,M.D. and Anderton,S.M.
Journal J. Immunol. 184 (6), 2839-2846 (2010)
Title MHC class I gene organization in > 1.5-Mb YAC contigs from the H2-M region .
Author Jones,E.P., Xiao,H., Schultz,R.A., Flaherty,L., Trachtulec,Z., Vincek,V., Larin,Z., Lehrach,H. and Lindahl,K.F.
Journal Genomics 27 (1), 40-51 (1995)
Title Localization of new genes and markers to the distal part of the human major histocompatibility complex (MHC) region and comparison with the mouse: new insights into the evolution of mammalian genomes .
Author Amadou,C., Ribouchon,M.T., Mattei,M.G., Jenkins,N.A., Gilbert,D.J., Copeland,N.G., Avoustin,P. and Pontarotti,P.
Journal Genomics 26 (1), 9-20 (1995)
Title Physical mapping of the human and mouse MOG gene at the distal end of the MHC class Ib region .
Author Pham-Dinh,D., Jones,E.P., Pitiot,G., Della Gaspera,B., Daubas,P., Mallet,J., Le Paslier,D., Fischer Lindahl,K. and Dautigny,A.
Journal Immunogenetics 42 (5), 386-391 (1995)
Title Structure and polymorphism of the mouse myelin/oligodendrocyte glycoprotein gene .
Author Daubas,P., Pham-Dinh,D. and Dautigny,A.
Journal Genomics 23 (1), 36-41 (1994)
Title Purification and partial structural and functional characterization of mouse myelin/oligodendrocyte glycoprotein .
Author Amiguet,P., Gardinier,M.V., Zanetta,J.P. and Matthieu,J.M.
Journal J. Neurochem. 58 (5), 1676-1682 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878