|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Mus musculus RAD9 homolog (S. pombe) (Rad9), mRNA.
| RefSeq Version | NM_011237.2, 133892125 |
| Length | 2046 bp |
| Structure | linear |
| Update Date | 27-FEB-2011 |
| Organism | Mus musculus (house mouse) |
| Definition | Mus musculus RAD9 homolog (S. pombe) (Rad9), mRNA. |
| Product | cell cycle checkpoint control protein RAD9A |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AC109138.10. On Mar 21, 2007 this sequence version replaced gi:6755281. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. |
| RefSeq | NP_035367.1 |
| CDS | 88..1257 | Exon (1) | 1..121 | Exon (2) | 1..121 | Exon (3) | 122..192 | Exon (4) | 193..321 | Exon (5) | 322..436 | Exon (6) | 437..536 | Exon (7) | 537..646 | Exon (8) | 647..756 | Exon (9) | 757..821 | Exon (10) | 822..959 | Exon (11) | 960..1161 | Exon (12) | 1162..2046 |
| Translation | MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAASPGQDLLRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKK
THNLSFQDCESLQAVFDPASCPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRS
YQEEEADSTSKAMVTETSIGDEDFQQLHAPEGIAVTFCLKEFRGLLSFAESANLPLTIHF
DVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKPHQPVPQKQAHSTPHLDDFTS
DDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTVPGTPPPKKFR
SLFFGSILAPVHSPQGPNPVLAEDSDGEG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(1268) | - | g, a | dbSNP:36732234 |
| complement(1696) | - | g, a | dbSNP:38678886 |
| complement(1999) | - | t, c | dbSNP:13473134 |
| Title | A high-resolution anatomical atlas of the transcriptome in the mouse embryo . |
| Author | Diez-Roux,G., Banfi,S., Sultan,M., Geffers,L., Anand,S., Rozado,D., Magen,A., Canidio,E., Pagani,M., Peluso,I., Lin-Marq,N., Koch,M., Bilio,M., Cantiello,I., Verde,R., De Masi,C., Bianchi,S.A., Cicchini,J., Perroud,E., Mehmeti,S., Dagand,E., Schrinner,S., Nurnberger,A., Schmidt,K., Metz,K., Zwingmann,C., Brieske,N., Springer,C., Hernandez,A.M., Herzog,S., Grabbe,F., Sieverding,C., Fischer,B., Schrader,K., Brockmeyer,M., Dettmer,S., Helbig,C., Alunni,V., Battaini,M.A., Mura,C., Henrichsen,C.N., Garcia-Lopez,R., Echevarria,D., Puelles,E., Garcia-Calero,E., Kruse,S., Uhr,M., Kauck,C., Feng,G., Milyaev,N., Ong,C.K., Kumar,L., Lam,M., Semple,C.A., Gyenesei,A., Mundlos,S., Radelof,U., Lehrach,H., Sarmientos,P., Reymond,A., Davidson,D.R., Dolle,P., Antonarakis,S.E., Yaspo,M.L., Martinez,S., Baldock,R.A., Eichele,G. and Ballabio,A. |
| Journal | PLoS Biol. 9 (1), E1000582 (2011) |
| Title | Rad9 is required for B cell proliferation and immunoglobulin class switch recombination . |
| Author | An,L., Wang,Y., Liu,Y., Yang,X., Liu,C., Hu,Z., He,W., Song,W. and Hang,H. |
| Journal | J. Biol. Chem. 285 (46), 35267-35273 (2010) |
| Title | Rad9A is required for G2 decatenation checkpoint and to prevent endoreduplication in response to topoisomerase II inhibition . |
| Author | Greer Card,D.A., Sierant,M.L. and Davey,S. |
| Journal | J. Biol. Chem. 285 (20), 15653-15661 (2010) |
| Title | The Rad9A checkpoint protein is required for nuclear localization of the claspin adaptor protein . |
| Author | Sierant,M.L., Archer,N.E. and Davey,S.K. |
| Journal | Cell Cycle 9 (3), 548-556 (2010) |
| Title | TLK1B promotes repair of DSBs via its interaction with Rad9 and Asf1 . |
| Author | Canfield,C., Rains,J. and De Benedetti,A. |
| Journal | BMC Mol. Biol. 10, 110 (2009) |
| Title | Expression of mammalian paralogues of HRAD9 and Mrad9 checkpoint control genes in normal and cancerous testicular tissue . |
| Author | Hopkins,K.M., Wang,X., Berlin,A., Hang,H., Thaker,H.M. and Lieberman,H.B. |
| Journal | Cancer Res. 63 (17), 5291-5298 (2003) |
| Title | Mutant alleles of Schizosaccharomyces pombe rad9(+) alter hydroxyurea resistance, radioresistance and checkpoint control . |
| Author | Hang,H., Rauth,S.J., Hopkins,K.M. and Lieberman,H.B. |
| Journal | Nucleic Acids Res. 28 (21), 4340-4349 (2000) |
| Title | Structure-based predictions of Rad1, Rad9, Hus1 and Rad17 participation in sliding clamp and clamp-loading complexes . |
| Author | Venclovas,C. and Thelen,M.P. |
| Journal | Nucleic Acids Res. 28 (13), 2481-2493 (2000) |
| Title | Molecular cloning and tissue-specific expression of Mrad9, a murine orthologue of the Schizosaccharomyces pombe rad9+ checkpoint control gene . |
| Author | Hang,H., Rauth,S.J., Hopkins,K.M., Davey,S.K. and Lieberman,H.B. |
| Journal | J. Cell. Physiol. 177 (2), 241-247 (1998) |
| Title | Specific contribution of Tyk2 JH regions to the binding and the expression of the interferon alpha/beta receptor component IFNAR1 . |
| Author | Richter,M.F., Dumenil,G., Uze,G., Fellous,M. and Pellegrini,S. |
| Journal | J. Biol. Chem. 273 (38), 24723-24729 (1998) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |