• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glyoxylate reductase/hydroxypyruvate reductase (GRHPR), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_012203 Homo sapiens glyoxylate reductase/hydroxypyruvate reductase (GRHPR), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_012203.1, 6912395
Length 1235 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens glyoxylate reductase/hydroxypyruvate reductase (GRHPR), mRNA.
Product glyoxylate reductase/hydroxypyruvate reductase
Comment

Summary: This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. [provided by RefSeq, Jul 2008].

RefSeq NP_036335.1
CDS 42..1028
Misc Feature(1)60..1022
Misc Feature(2)60..1022
Misc Feature(3)60..998
Misc Feature(4)order(78..83,87..89,213..221,282..284,366..371,378..383,
Misc Feature(5)order(216..218,285..293,360..362,774..776,918..920,
Misc Feature(6)order(288..293,372..374,519..533,588..596,603..605,
Misc Feature(7)288..293
Misc Feature(8)order(774..776,861..863,918..920)
Misc Feature(9)861..863
Misc Feature(10)918..929
Exon (1)1..124
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (2)125..255
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (3)256..328
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (4)329..445
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (5)446..534
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (6)535..639
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (7)640..775
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (8)776..906
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Exon (9)907..1235
Gene:GRHPR
Gene Synonym:GLXR; GLYD; PH2
Translation MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLS DHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLL TTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRF LYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVF INISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHR TRNTMSLLAANNLLAGLRGEPMPSELKL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
19+dbSNP:
19+a, cdbSNP:377087833
27+a, gdbSNP:370961823
38+a, gdbSNP:201826196
39+c, tdbSNP:200847843
57+c, tdbSNP:147185003
59+c, gdbSNP:111232251
86+, adbSNP:180177311
92+c, tdbSNP:138843824
134+dbSNP:
134+a, gdbSNP:141330907
143+a, gdbSNP:180177304
144+, gdbSNP:80356708
149+a, gdbSNP:377072887
177+c, gdbSNP:202022170
190+c, tdbSNP:150805048
191+a, gdbSNP:369721488
221+c, tdbSNP:139689525
222+a, gdbSNP:371660673
242+a, cdbSNP:149782105
244+c, tdbSNP:180177305
275+dbSNP:
275+c, tdbSNP:143337459
293+a, cdbSNP:139595138
296+c, tdbSNP:372985143
327+c, tdbSNP:78920863
329+dbSNP:
329+c, tdbSNP:201553816
333+a, tdbSNP:374332294
336+c, tdbSNP:119490108
337+a, gdbSNP:146603229
344+c, tdbSNP:11546644
complement(346)-t, cdbSNP:35975284
348+a, gdbSNP:377116902
364+c, tdbSNP:370530139
377+c, tdbSNP:148778319
378+a, gdbSNP:180177307
383+c, tdbSNP:374108537
384+a, gdbSNP:113602485
386+a, tdbSNP:147053190
393+c, tdbSNP:182258378
398+a, gdbSNP:186922220
399+c, tdbSNP:11546642
406+c, tdbSNP:200249904
411+c, tdbSNP:372712521
415+a, gdbSNP:199560759
416+, gdbSNP:180177308
422+a, gdbSNP:151336686
425+a, gdbSNP:372351685
432+a, gdbSNP:369339903
481+dbSNP:
481+a, gdbSNP:201661750
497+a, gdbSNP:140612021
509+c, tdbSNP:142509393
519+a, gdbSNP:180177312
535+dbSNP:
535+a, gdbSNP:180177314
550+a, gdbSNP:12002324
552+c, tdbSNP:370733771
553+a, gdbSNP:200106110
567+a, gdbSNP:377374419
581+, tdbSNP:180177315
584+c, gdbSNP:370395134
620+a, gdbSNP:309458
649..650+dbSNP:
649..650+, ctdbSNP:180177316
667+c, tdbSNP:375014308
678+a, gdbSNP:145899443
697+c, tdbSNP:368512158
704+a, gdbSNP:138575944
707+c, tdbSNP:146227450
723+a, gdbSNP:74692381
727+a, tdbSNP:202212690
731+a, cdbSNP:185747820
742+c, tdbSNP:143596402
781+dbSNP:
781+a, gdbSNP:180177318
783+a, gdbSNP:369950120
785+c, tdbSNP:373541730
798+a, gdbSNP:376446449
803+a, gdbSNP:201872828
812+c, gdbSNP:367671150
818+c, tdbSNP:201303429
842+a, cdbSNP:141800325
847+a, gdbSNP:369698939
854+a, gdbSNP:373622439
885+c, tdbSNP:202120724
887+c, gdbSNP:146293016
892+a, cdbSNP:200326253
893+c, tdbSNP:375012546
905..906+, tgdbSNP:180177321
912+dbSNP:
912+c, tdbSNP:1135283
921+a, gdbSNP:139554205
930+a, gdbSNP:200632069
945+c, tdbSNP:180177322
946+a, gdbSNP:180177323
975+a, gdbSNP:180177324
996+g, tdbSNP:142835989
1003+c, tdbSNP:142356700
1004+a, gdbSNP:76299266
1006+c, g, tdbSNP:180177325
1028+a, gdbSNP:371501708
1051+c, tdbSNP:374742361
1052+a, gdbSNP:202111075
1064+a, gdbSNP:370704714
1146+a, gdbSNP:115124458
1154+c, tdbSNP:3198078
1174+a, gdbSNP:1057507
Gene SymbolGRHPR
Gene SynonymGLXR; GLYD; PH2
Chromosome9
Locus Map9q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_012203 Homo sapiens glyoxylate reductase/hydroxypyruvate reductase (GRHPR), mRNA. On-demand $549.00 14
XM_005251631 PREDICTED: Homo sapiens glyoxylate reductase/hydroxypyruvate reductase (GRHPR), transcript variant X1, mRNA. On-demand $399.00 14
Title Glyoxalate reductase/hydroxypyruvate reductase interacts with the sodium-dependent vitamin C transporter-1 to regulate cellular vitamin C homeostasis .
Author Subramanian VS, Nabokina SM, Patton JR, Marchant JS, Moradi H and Said HM.
Journal Am. J. Physiol. Gastrointest. Liver Physiol. 304 (12), G1079-G1086 (2013)
Title Glyoxylate reductase/hydroxypyruvate reductase: a novel prognostic marker for hepatocellular carcinoma patients after curative resection .
Author Pan Y, Ni R, Deng Q, Huang X, Zhang Y, Lu C, Li F, Huang D, He S and Chen B.
Journal Pathobiology 80 (3), 155-162 (2013)
Title Late diagnosis of primary hyperoxaluria type 2 in the adult: effect of a novel mutation in GRHPR gene on enzymatic activity and molecular modeling .
Author Levin-Iaina N, Dinour D, Romero L, Ron R, Brady RL, Cramer SD and Holtzman EJ.
Journal J. Urol. 181 (5), 2146-2151 (2009)
Title Large-scale proteomics and phosphoproteomics of urinary exosomes .
Author Gonzales PA, Pisitkun T, Hoffert JD, Tchapyjnikov D, Star RA, Kleta R, Wang NS and Knepper MA.
Journal J. Am. Soc. Nephrol. 20 (2), 363-379 (2009)
Title A novel mutation in the GRHPR gene in a Japanese patient with primary hyperoxaluria type 2 .
Author Takayama T, Nagata M, Ozono S, Nonomura K and Cramer SD.
Journal Nephrol. Dial. Transplant. 22 (8), 2371-2374 (2007)
Title Identification of missense, nonsense, and deletion mutations in the .
Author Webster KE, Ferree PM, Holmes RP and Cramer SD.
Journal Hum. Genet. 107 (2), 176-185 (2000)
Title Cloning and characterization of a putative human d-2-hydroxyacid dehydrogenase in chromosome 9q .
Author Huang T, Yang W, Pereira AC, Craigen WJ and Shih VE.
Journal Biochem. Biophys. Res. Commun. 268 (2), 298-301 (2000)
Title The gene encoding hydroxypyruvate reductase (GRHPR) is mutated in patients with primary hyperoxaluria type II .
Author Cramer SD, Ferree PM, Lin K, Milliner DS and Holmes RP.
Journal Hum. Mol. Genet. 8 (11), 2063-2069 (1999)
Title Identification and expression of a cDNA for human hydroxypyruvate/glyoxylate reductase .
Author Rumsby G and Cregeen DP.
Journal Biochim. Biophys. Acta 1446 (3), 383-388 (1999)
Title Primary Hyperoxaluria Type 2 .
Author Rumsby,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.