• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_012307 Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_012307.3, 528281417
Length 4777 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant 1, mRNA.
Product band 4.1-like protein 3 isoform 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA317127.1, AB023204.1, AK297406.1 and DB301724.1. On Jul 31, 2013 this sequence version replaced gi:32490571.


Transcript Variant: This variant (1) encodes the longest isoform (1).

RefSeq NP_036439.2
CDS 410..3673
Misc Feature(1)29..31
Misc Feature(2)29..31
Misc Feature(3)410..412
Misc Feature(4)410..412
Misc Feature(5)413..415
Misc Feature(6)671..673
Misc Feature(7)743..1312
Misc Feature(8)749..979
Misc Feature(9)995..1312
Misc Feature(10)1235..1573
Misc Feature(11)order(1322..1324,1373..1375,1379..1381,1397..1399)
Misc Feature(12)order(1409..1411,1424..1435,1538..1540,1550..1552,
Misc Feature(13)1538..1573
Misc Feature(14)1589..1948
Misc Feature(15)1598..1738
Misc Feature(16)1634..1636
Misc Feature(17)1787..1789
Misc Feature(18)1787..1789
Misc Feature(19)1814..1816
Misc Feature(20)1814..1816
Misc Feature(21)1949..2989
Misc Feature(22)2531..2533
Misc Feature(23)2558..2704
Misc Feature(24)2990..3658
Misc Feature(25)3293..3295
Misc Feature(26)3293..3295
Misc Feature(27)3308..3649
Exon (1)1..398
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (2)399..592
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (3)593..790
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (4)791..895
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (5)896..938
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (6)939..1014
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (7)1015..1233
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (8)1234..1321
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (9)1322..1474
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (10)1475..1572
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (11)1573..1748
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (12)1749..1915
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (13)1916..2476
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (14)2477..2530
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (15)2531..2566
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (16)2567..2758
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (17)2759..2881
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (18)2882..3250
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (19)3251..3382
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (20)3383..3481
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (21)3482..3562
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (22)3563..3679
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (23)3680..4777
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Translation MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRR EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE EEDKRRKGEEVTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLP GYEPSRAEHLPGEPALDSDGPGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLL DDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPL ALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQE LEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLV PEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGS VSPGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTT HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI TPEDGED
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(117)-g, cdbSNP:138850210
complement(160)-g, cdbSNP:113451037
complement(275)-g, adbSNP:190510766
complement(470)-t, cdbSNP:370004609
complement(482)-t, cdbSNP:376398436
502+a, g, tdbSNP:11548490
complement(516)-t, gdbSNP:61735458
complement(538)-t, cdbSNP:369422508
complement(553)-g, adbSNP:374406358
complement(567)-g, adbSNP:376734530
complement(585)-t, cdbSNP:150166347
complement(671)-dbSNP:
complement(671)-g, adbSNP:370452607
complement(682)-t, gdbSNP:376036017
complement(694)-t, cdbSNP:183237730
complement(702)-t, cdbSNP:142277051
complement(703)-t, cdbSNP:200511617
complement(735)-c, adbSNP:117900256
complement(754)-t, cdbSNP:113126204
complement(760)-g, adbSNP:145256842
complement(790)-t, cdbSNP:199604887
complement(794)-dbSNP:
complement(794)-t, gdbSNP:372730881
complement(796)-t, gdbSNP:201356819
complement(870)-g, adbSNP:201907753
complement(876)-t, cdbSNP:141362076
complement(963)-dbSNP:
complement(963)-t, cdbSNP:369470003
complement(1016)-dbSNP:
complement(1016)-c, adbSNP:375147810
complement(1034)-g, adbSNP:368600153
complement(1099)-g, adbSNP:143402263
complement(1104)-g, cdbSNP:181887485
complement(1105)-g, adbSNP:375531382
complement(1111)-g, cdbSNP:201054385
complement(1117)-t, cdbSNP:201959221
complement(1126)-g, adbSNP:368191543
complement(1150)-g, adbSNP:200327567
complement(1169)-g, adbSNP:374307563
complement(1177)-t, cdbSNP:142133892
complement(1213)-g, cdbSNP:200272088
complement(1242)-dbSNP:
complement(1242)-g, adbSNP:376210046
complement(1243)-t, cdbSNP:201803688
complement(1260)-c, adbSNP:376224922
complement(1309)-t, cdbSNP:374364503
complement(1464)-dbSNP:
complement(1464)-t, cdbSNP:377615645
complement(1468)-t, cdbSNP:374264467
complement(1476)-dbSNP:
complement(1476)-t, adbSNP:374596275
complement(1483)-t, cdbSNP:141190287
complement(1516)-g, adbSNP:371768891
complement(1558)-g, adbSNP:367552570
complement(1621)-dbSNP:
complement(1621)-g, adbSNP:375583326
complement(1657)-c, adbSNP:202106014
complement(1672)-t, cdbSNP:200289520
complement(1693)-c, adbSNP:150051905
complement(1716)-t, cdbSNP:201007636
complement(1734)-t, cdbSNP:201730957
complement(1750)-dbSNP:
complement(1750)-t, cdbSNP:11661706
complement(1769)-t, cdbSNP:145954134
complement(1774)-t, cdbSNP:369313726
complement(1827)-t, cdbSNP:146356489
complement(1862)-g, adbSNP:188980250
complement(1871)-t, cdbSNP:375665706
complement(1884)-t, gdbSNP:142122200
complement(1901)-g, adbSNP:200213263
complement(1902)-t, cdbSNP:117538203
complement(1954)-dbSNP:
complement(1954)-g, adbSNP:369506575
complement(1962)-g, adbSNP:374487187
complement(1975)-g, adbSNP:111274175
complement(1983)-g, adbSNP:199822438
complement(1994)-g, adbSNP:150384501
complement(2004)-t, cdbSNP:148074485
complement(2018)-g, adbSNP:375525801
complement(2030)-t, cdbSNP:372345879
complement(2040)-g, adbSNP:369688255
complement(2041)-t, cdbSNP:201925314
complement(2071)-g, adbSNP:200875404
complement(2072)-t, cdbSNP:9966357
complement(2116)-t, cdbSNP:191005310
complement(2120)-g, cdbSNP:375555518
complement(2133)-t, cdbSNP:8082898
complement(2148)-t, cdbSNP:138184132
complement(2181)-t, cdbSNP:147018763
complement(2206)-, gdbSNP:36014038
complement(2284)-g, adbSNP:368126962
complement(2286)-g, adbSNP:141321874
complement(2287)-t, cdbSNP:145588627
complement(2291)-g, adbSNP:150101312
complement(2302)-g, adbSNP:140780596
complement(2350)-g, adbSNP:376632559
complement(2365)-g, adbSNP:186596462
complement(2366)-t, cdbSNP:201249884
complement(2373)-t, gdbSNP:150922981
complement(2375)-g, adbSNP:144002108
complement(2390)-t, cdbSNP:139124528
complement(2422)-t, cdbSNP:375430348
complement(2435)-t, cdbSNP:371099425
complement(2448)-t, cdbSNP:140386239
complement(2473)-t, cdbSNP:199744753
complement(2489)-dbSNP:
complement(2489)-g, adbSNP:143942399
complement(2490)-t, cdbSNP:375743953
complement(2493)-g, adbSNP:373780287
complement(2501)-t, cdbSNP:201553363
complement(2506)-g, c, adbSNP:140128908
complement(2507)-t, cdbSNP:61731698
complement(2509)-g, adbSNP:61731697
complement(2518..2519)-, ggdbSNP:151237222
2521+c, tdbSNP:3817466
complement(2532)-dbSNP:
complement(2532)-g, adbSNP:149578114
complement(2605)-dbSNP:
complement(2605)-t, cdbSNP:368826257
2646+g, tdbSNP:75643723
complement(2660)-t, g, cdbSNP:140941017
complement(2664)-g, adbSNP:139317911
complement(2665)-t, cdbSNP:375906975
complement(2686)-c, adbSNP:147295760
complement(2699)-t, cdbSNP:142982382
complement(2750)-g, adbSNP:139078158
complement(2767)-dbSNP:
complement(2767)-g, cdbSNP:147008674
complement(2771..2772)-, cdbSNP:35009667
complement(2852)-c, adbSNP:202241333
complement(2856)-g, adbSNP:142893326
complement(2903)-dbSNP:
complement(2903)-c, adbSNP:116459026
complement(2919)-g, adbSNP:143141379
complement(2920)-t, cdbSNP:190403676
complement(2924)-g, adbSNP:61736460
complement(2929)-g, adbSNP:376017456
complement(2930)-t, cdbSNP:151294672
complement(2936)-g, adbSNP:377637300
complement(2939)-g, adbSNP:145385312
complement(2943)-g, adbSNP:140230336
complement(2944)-t, cdbSNP:374267593
complement(2973)-g, adbSNP:146680155
complement(2974)-t, gdbSNP:201195904
complement(2977)-t, cdbSNP:376595415
complement(2980)-t, cdbSNP:201740894
complement(2981)-t, cdbSNP:200113280
complement(2984)-g, cdbSNP:8096452
complement(2990)-g, adbSNP:139997557
complement(2992)-t, cdbSNP:151082224
complement(2993)-g, adbSNP:368913981
complement(2994)-t, cdbSNP:200869858
complement(3003)-t, cdbSNP:200823240
complement(3005)-t, cdbSNP:375861416
complement(3009)-t, cdbSNP:142911764
complement(3011)-t, cdbSNP:148568579
complement(3014)-c, adbSNP:147480786
complement(3031)-g, cdbSNP:372107087
complement(3040)-g, adbSNP:143155897
complement(3041)-t, cdbSNP:140662824
complement(3046)-g, adbSNP:199769741
complement(3061)-g, adbSNP:369967519
complement(3062)-t, cdbSNP:147247153
complement(3068)-t, cdbSNP:375162726
complement(3102)-g, adbSNP:142853345
complement(3103)-t, cdbSNP:79015463
complement(3121)-t, adbSNP:372013672
complement(3126)-t, cdbSNP:367962784
complement(3160)-t, cdbSNP:373883429
complement(3168)-t, gdbSNP:372185496
complement(3169)-g, adbSNP:192974284
complement(3179)-g, adbSNP:146075320
complement(3180)-t, cdbSNP:371240117
complement(3215)-t, cdbSNP:200496501
complement(3247)-g, adbSNP:377748200
complement(3250)-g, cdbSNP:150175125
complement(3258)-dbSNP:
complement(3258)-t, gdbSNP:61735459
complement(3268)-t, cdbSNP:148045283
complement(3298)-t, cdbSNP:375597366
complement(3310)-t, cdbSNP:145344390
complement(3324)-g, adbSNP:79592897
complement(3350)-t, cdbSNP:371591392
complement(3375)-g, adbSNP:138017302
complement(3385)-dbSNP:
complement(3385)-g, adbSNP:116148637
complement(3386)-c, adbSNP:145834920
complement(3400)-t, adbSNP:144613208
complement(3412)-t, g, adbSNP:149824211
complement(3418)-g, cdbSNP:368249382
complement(3469)-t, cdbSNP:375353039
complement(3472)-g, adbSNP:202000684
complement(3481)-t, cdbSNP:200474691
complement(3484)-dbSNP:
complement(3484)-g, adbSNP:145398752
complement(3513)-g, adbSNP:150071835
complement(3530)-t, cdbSNP:140548684
complement(3534)-g, adbSNP:147930423
complement(3535)-t, cdbSNP:144676596
complement(3549)-g, adbSNP:368752856
3556+a, tdbSNP:1802388
complement(3573)-dbSNP:
complement(3573)-t, cdbSNP:201592629
complement(3603)-t, gdbSNP:190875358
complement(3631)-g, cdbSNP:371494173
complement(3669)-t, adbSNP:199616331
complement(3670)-t, adbSNP:140830660
complement(3676)-t, gdbSNP:199831654
complement(3763)-dbSNP:
complement(3763)-t, cdbSNP:199863531
complement(3908)-g, adbSNP:11548489
3967+a, tdbSNP:1140830
complement(3993)-t, adbSNP:373731702
complement(4133)-g, adbSNP:80008114
complement(4204)-c, adbSNP:187122208
complement(4259)-g, adbSNP:181159929
complement(4273)-t, cdbSNP:73373999
complement(4273)-g, adbSNP:386440601
complement(4284)-t, gdbSNP:369712232
complement(4326)-c, adbSNP:72865098
complement(4346)-t, cdbSNP:141378527
complement(4353)-g, adbSNP:369819844
4381+g, tdbSNP:148690503
complement(4504)-t, adbSNP:9953490
complement(4512)-g, adbSNP:189939395
complement(4596)-g, cdbSNP:368268009
4634+a, cdbSNP:1140836
complement(4634)-c, adbSNP:386518158
complement(4651)-t, adbSNP:371511364
complement(4659)-, tdbSNP:371333000
4689+c, tdbSNP:1140837
complement(4695)-g, adbSNP:144097441
complement(4708)-t, cdbSNP:73937119
complement(4766)-t, cdbSNP:367633963
Gene SymbolEPB41L3
Gene Synonym4.1B; DAL-1; DAL1
Chromosome18
Locus Map18p11.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001281535 Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant 4, mRNA. On-demand $849.00 20
NM_001281533 Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant 2, mRNA. On-demand TBD TBD
NM_001281534 Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant 3, mRNA. On-demand TBD TBD
NM_012307 Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant 1, mRNA. On-demand TBD TBD
XM_006722301 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X9, mRNA. On-demand TBD TBD
XM_006722302 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X10, mRNA. On-demand TBD TBD
XM_005258085 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X2, mRNA. On-demand TBD TBD
XM_006722303 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X11, mRNA. On-demand TBD TBD
XM_006722304 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X12, mRNA. On-demand TBD TBD
XM_005258086 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X3, mRNA. On-demand TBD TBD
XM_006722305 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X13, mRNA. On-demand TBD TBD
XM_006722306 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X14, mRNA. On-demand TBD TBD
XM_006722307 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X15, mRNA. On-demand TBD TBD
XM_006722308 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X16, mRNA. On-demand TBD TBD
XM_005258087 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X4, mRNA. On-demand TBD TBD
XM_006722309 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X17, mRNA. On-demand TBD TBD
XM_006722310 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X18, mRNA. On-demand TBD TBD
XM_005258088 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X5, mRNA. On-demand TBD TBD
XM_006722311 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X19, mRNA. On-demand TBD TBD
XM_006722312 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X20, mRNA. On-demand TBD TBD
XM_006722313 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X21, mRNA. On-demand TBD TBD
XM_006722314 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X22, mRNA. On-demand TBD TBD
XM_006722315 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X23, mRNA. On-demand TBD TBD
XM_005258089 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X6, mRNA. On-demand TBD TBD
XM_005258090 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X7, mRNA. On-demand TBD TBD
XM_005258091 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X8, mRNA. On-demand TBD TBD
XM_006722316 PREDICTED: Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), transcript variant X24, mRNA. On-demand TBD TBD
Title Loss of expression of the differentially expressed in adenocarcinoma of the lung (DAL-1) protein is associated with metastasis of non-small cell lung carcinoma cells .
Author Zhang Y, Xu R, Li G, Xie X, Long J and Wang H.
Journal Tumour Biol. 33 (6), 1915-1925 (2012)
Title Aberrant expression of tumor suppressors CADM1 and 4.1B in invasive lesions of primary breast cancer .
Author Takahashi Y, Iwai M, Kawai T, Arakawa A, Ito T, Sakurai-Yageta M, Ito A, Goto A, Saito M, Kasumi F and Murakami Y.
Journal Breast Cancer 19 (3), 242-252 (2012)
Title A four-gene methylation marker panel as triage test in high-risk human papillomavirus positive patients .
Author Eijsink JJ, Lendvai A, Deregowski V, Klip HG, Verpooten G, Dehaspe L, de Bock GH, Hollema H, van Criekinge W, Schuuring E, van der Zee
Journal Int. J. Cancer 130 (8), 1861-1869 (2012)
Title miRNA-223 promotes gastric cancer invasion and metastasis by targeting tumor suppressor EPB41L3 .
Author Li X, Zhang Y, Zhang H, Liu X, Gong T, Li M, Sun L, Ji G, Shi Y, Han Z, Han S, Nie Y, Chen X, Zhao Q, Ding J, Wu K and Daiming F.
Journal Mol. Cancer Res. 9 (7), 824-833 (2011)
Title Structural basis of tumor suppressor in lung cancer 1 (TSLC1) binding to differentially expressed in adenocarcinoma of the lung (DAL-1/4.1B) .
Author Busam RD, Thorsell AG, Flores A, Hammarstrom M, Persson C, Obrink B and Hallberg BM.
Journal J. Biol. Chem. 286 (6), 4511-4516 (2011)
Title Evolutionarily conserved coupling of transcription and alternative splicing in the EPB41 (protein 4.1R) and EPB41L3 (protein 4.1B) genes .
Author Tan JS, Mohandas N and Conboy JG.
Journal Genomics 86 (6), 701-707 (2005)
Title A novel member of the NF2/ERM/4.1 superfamily with growth suppressing properties in lung cancer .
Author Tran YK, Bogler O, Gorse KM, Wieland I, Green MR and Newsham IF.
Journal Cancer Res. 59 (1), 35-43 (1999)
Title Four paralogous protein 4.1 genes map to distinct chromosomes in mouse and human .
Author Peters LL, Weier HU, Walensky LD, Snyder SH, Parra M, Mohandas N and Conboy JG.
Journal Genomics 54 (2), 348-350 (1998)
Title Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence .
Author Adams MD, Kerlavage AR, Fleischmann RD, Fuldner RA, Bult CJ, Lee NH, Kirkness EF, Weinstock KG, Gocayne JD and White O.
Journal Nature 377 (6547 SUPPL), 3-174 (1995)
Title Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library .
Author Adams MD, Soares MB, Kerlavage AR, Fields C and Venter JC.
Journal Nat. Genet. 4 (4), 373-380 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.