Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), mRNA.
| RefSeq Version | NM_012307.2, 32490571 |
| Length | 4446 bp |
| Structure | linear |
| Update Date | 27-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), mRNA. |
| Product | band 4.1-like protein 3 |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB023204.1. On Jul 10, 2003 this sequence version replaced gi:6912469. |
| RefSeq | NP_036439.2 |
| CDS | 87..3350 | Exon (1) | 1..75 | Exon (2) | 1..75 | Exon (3) | 76..269 | Exon (4) | 270..467 | Exon (5) | 468..572 | Exon (6) | 573..615 | Exon (7) | 616..691 | Exon (8) | 692..910 | Exon (9) | 911..998 | Exon (10) | 999..1151 | Exon (11) | 1152..1249 | Exon (12) | 1250..1425 | Exon (13) | 1426..1592 | Exon (14) | 1593..2153 | Exon (15) | 2154..2207 | Exon (16) | 2208..2243 | Exon (17) | 2244..2435 | Exon (18) | 2436..2558 | Exon (19) | 2559..2927 | Exon (20) | 2928..3059 | Exon (21) | 3060..3158 | Exon (22) | 3159..3239 | Exon (23) | 3240..3356 | Exon (24) | 3357..4446 |
| Translation | MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRR
EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS
EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE
EEDKRRKGEEVTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLP
GYEPSRAEHLPGEPALDSDGPGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLL
DDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPL
ALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQE
LEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLV
PEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT
VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG
AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGS
VSPGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTT
HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI
TPEDGED
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 179 | + | a, g, t | dbSNP:11548490 |
| complement(193) | - | t, g | dbSNP:61735458 |
| complement(412) | - | c, a | dbSNP:117900256 |
| complement(431) | - | t, c | dbSNP:113126204 |
| complement(1427) | - | t, c | dbSNP:11661706 |
| complement(1579) | - | t, c | dbSNP:117538203 |
| complement(1652) | - | g, a | dbSNP:111274175 |
| complement(1749) | - | t, c | dbSNP:9966357 |
| complement(1810) | - | t, c | dbSNP:8082898 |
| complement(1883) | - | , g | dbSNP:36014038 |
| complement(2184) | - | t, c | dbSNP:61731698 |
| complement(2186) | - | g, a | dbSNP:61731697 |
| 2198 | + | c, t | dbSNP:3817466 |
| complement(2323) | - | t, g | dbSNP:75643723 |
| complement(2448..2449) | - | , c | dbSNP:35009667 |
| complement(2580) | - | c, a | dbSNP:116459026 |
| complement(2601) | - | g, a | dbSNP:61736460 |
| complement(2661) | - | g, c | dbSNP:8096452 |
| complement(2780) | - | t, c | dbSNP:79015463 |
| complement(2935) | - | t, g | dbSNP:61735459 |
| complement(3001) | - | g, a | dbSNP:79592897 |
| complement(3062) | - | g, a | dbSNP:116148637 |
| 3233 | + | a, t | dbSNP:1802388 |
| complement(3585) | - | g, a | dbSNP:11548489 |
| 3644 | + | a, t | dbSNP:1140830 |
| complement(3810) | - | g, a | dbSNP:80008114 |
| complement(3950) | - | t, c | dbSNP:73373999 |
| complement(4003) | - | c, a | dbSNP:72865098 |
| complement(4181) | - | t, a | dbSNP:9953490 |
| complement(4189) | - | g, a | dbSNP:76458533 |
| 4311 | + | a, c | dbSNP:1140836 |
| 4366 | + | c, t | dbSNP:1140837 |
| complement(4385) | - | t, c | dbSNP:73937119 |
| Gene Symbol | EPB41L3 |
| Gene Synonym | 4.1B; DAL-1; DAL1; FLJ37633; KIAA0987 |
| Chromosome | 18 |
| Locus Map | 18p11.32 |
| All Transcripts | NM_012307 |
| Title | Structural basis of tumor suppressor in lung cancer 1 (TSLC1) binding to differentially expressed in adenocarcinoma of the lung (DAL-1/4.1B) . |
| Author | Busam,R.D., Thorsell,A.G., Flores,A., Hammarstrom,M., Persson,C., Obrink,O. and Hallberg,B.M. |
| Journal | J. Biol. Chem. 286 (6), 4511-4516 (2011) |
| Title | [Expressions and clinical significances of TSLC1 and 4.1B in non-small cell lung cancer] . |
| Author | Wang,Z., Yang,K., Wang,X., Zhang,J., Hao,D. and Chen,Z. |
| Journal | Zhongguo Fei Ai Za Zhi 13 (11), 1041-1045 (2010) |
| Title | Microcell-mediated chromosome transfer identifies EPB41L3 as a functional suppressor of epithelial ovarian cancers . |
| Author | Dafou,D., Grun,B., Sinclair,J., Lawrenson,K., Benjamin,E.C., Hogdall,E., Kruger-Kjaer,S., Christensen,L., Sowter,H.M., Al-Attar,A., Edmondson,R., Darby,S., Berchuck,A., Laird,P.W., Pearce,C.L., Ramus,S.J., Jacobs,I.J. and Gayther,S.A. |
| Journal | Neoplasia 12 (7), 579-589 (2010) |
| Title | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score . |
| Author | Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R. |
| Journal | Mol. Med. 16 (7-8), 247-253 (2010) |
| Title | SynCAM1 recruits NMDA receptors via protein 4.1B . |
| Author | Hoy,J.L., Constable,J.R., Vicini,S., Fu,Z. and Washbourne,P. |
| Journal | Mol. Cell. Neurosci. 42 (4), 466-483 (2009) |
| Title | Loss of DAL-1, a protein 4.1-related tumor suppressor, is an important early event in the pathogenesis of meningiomas . |
| Author | Gutmann,D.H., Donahoe,J., Perry,A., Lemke,N., Gorse,K., Kittiniyom,K., Rempel,S.A., Gutierrez,J.A. and Newsham,I.F. |
| Journal | Hum. Mol. Genet. 9 (10), 1495-1500 (2000) |
| Title | A novel member of the NF2/ERM/4.1 superfamily with growth suppressing properties in lung cancer . |
| Author | Tran,Y.K., Bogler,O., Gorse,K.M., Wieland,I., Green,M.R. and Newsham,I.F. |
| Journal | Cancer Res. 59 (1), 35-43 (1999) |
| Title | Four paralogous protein 4.1 genes map to distinct chromosomes in mouse and human . |
| Author | Peters,L.L., Weier,H.U., Walensky,L.D., Snyder,S.H., Parra,M., Mohandas,N. and Conboy,J.G. |
| Journal | Genomics 54 (2), 348-350 (1998) |
| Title | Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence . |
| Author | Adams,M.D., Kerlavage,A.R., Fleischmann,R.D., Fuldner,R.A., Bult,C.J., Lee,N.H., Kirkness,E.F., Weinstock,K.G., Gocayne,J.D., White,O. et al. |
| Journal | Nature 377 (6547 SUPPL), 3-174 (1995) |
| Title | Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library . |
| Author | Adams,M.D., Soares,M.B., Kerlavage,A.R., Fields,C. and Venter,J.C. |
| Journal | Nat. Genet. 4 (4), 373-380 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |