• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), mRNA.


RefSeq Accession Definition Services Price Order
NM_012307 Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), mRNA. ORF Sequence $1142.40
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_012307.2, 32490571
Length 4446 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), mRNA.
Product band 4.1-like protein 3
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB023204.1. On Jul 10, 2003 this sequence version replaced gi:6912469.

RefSeq NP_036439.2
CDS 87..3350
Misc Feature(1)348..350
Misc Feature(2)348..350
Misc Feature(3)420..989
Misc Feature(4)426..656
Misc Feature(5)672..989
Misc Feature(6)969..1250
Misc Feature(7)order(981..1004,1011..1034,1038..1058,1086..1091,
Misc Feature(8)order(1095..1097,1101..1106,1110..1118,1140..1142,
Misc Feature(9)1206..1208
Misc Feature(10)1266..1625
Misc Feature(11)1275..1415
Misc Feature(12)1311..1313
Misc Feature(13)1464..1466
Misc Feature(14)1464..1466
Misc Feature(15)1491..1493
Misc Feature(16)1491..1493
Misc Feature(17)1626..2666
Misc Feature(18)2208..2210
Misc Feature(19)2235..2381
Misc Feature(20)2667..3335
Misc Feature(21)2970..2972
Misc Feature(22)2970..2972
Misc Feature(23)2985..3326
Exon (1)1..75
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (2)76..269
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (3)270..467
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (4)468..572
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (5)573..615
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (6)616..691
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (7)692..910
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (8)911..998
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (9)999..1151
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (10)1152..1249
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (11)1250..1425
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (12)1426..1592
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (13)1593..2153
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (14)2154..2207
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (15)2208..2243
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (16)2244..2435
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (17)2436..2558
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (18)2559..2927
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (19)2928..3059
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (20)3060..3158
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (21)3159..3239
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (22)3240..3356
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Exon (23)3357..4446
Gene:EPB41L3
Gene Synonym:4.1B; DAL-1; DAL1
Translation MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRR EVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGS EYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAW HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY DPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS ALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDE EEDKRRKGEEVTPISAIRHEGKSPGLGTDSCPLSPPSTHCAPTSPTELRRRCKENDCKLP GYEPSRAEHLPGEPALDSDGPGRPYLGDQDVAFSYRQQTGKGTTLFSFSLQLPESFPSLL DDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPL ALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQE LEKTQDDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLAARQEDAPMIEPLV PEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQKMETKTESSGIETEPT VHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEG AKEEGGEEVAKAVLEQEETAAASRERQEEQSAAIHISETLEQKPHFESSTVKTETISFGS VSPGGVKLEISTKEVPVVHTETKTITYESSQVDPGTDLEPGVLMSAQTITSETTSTTTTT HITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEI TPEDGED
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(179)-t, g, adbSNP:11548490
complement(193)-t, gdbSNP:61735458
complement(262)-t, cdbSNP:150166347
complement(371)-dbSNP:
complement(371)-t, cdbSNP:183237730
complement(379)-t, cdbSNP:142277051
complement(380)-t, cdbSNP:200511617
complement(412)-c, adbSNP:117900256
complement(431)-t, cdbSNP:113126204
complement(437)-g, adbSNP:145256842
complement(467)-t, cdbSNP:199604887
complement(473)-dbSNP:
complement(473)-t, gdbSNP:201356819
complement(547)-g, adbSNP:201907753
complement(553)-t, cdbSNP:141362076
complement(776)-dbSNP:
complement(776)-g, adbSNP:143402263
complement(781)-g, cdbSNP:181887485
complement(788)-g, cdbSNP:201054385
complement(794)-t, cdbSNP:201959221
complement(827)-g, adbSNP:200327567
complement(854)-t, cdbSNP:142133892
complement(890)-g, cdbSNP:200272088
complement(920)-dbSNP:
complement(920)-t, cdbSNP:201803688
complement(1160)-dbSNP:
complement(1160)-t, cdbSNP:141190287
complement(1327)-dbSNP:
complement(1327)-g, adbSNP:143872851
complement(1334)-c, adbSNP:202106014
complement(1349)-t, cdbSNP:200289520
complement(1370)-c, adbSNP:150051905
complement(1393)-t, cdbSNP:201007636
complement(1411)-t, cdbSNP:201730957
complement(1427)-dbSNP:
complement(1427)-t, cdbSNP:11661706
complement(1432)-c, adbSNP:139768377
complement(1446)-t, cdbSNP:145954134
complement(1504)-t, cdbSNP:146356489
complement(1539)-g, adbSNP:188980250
complement(1561)-t, gdbSNP:142122200
complement(1578)-g, adbSNP:200213263
complement(1579)-t, cdbSNP:117538203
complement(1652)-dbSNP:
complement(1652)-g, adbSNP:111274175
complement(1660)-g, adbSNP:199822438
complement(1671)-g, adbSNP:150384501
complement(1681)-t, cdbSNP:148074485
complement(1718)-t, cdbSNP:201925314
complement(1748)-g, adbSNP:200875404
complement(1749)-t, cdbSNP:9966357
complement(1793)-t, cdbSNP:191005310
complement(1810)-t, cdbSNP:8082898
complement(1825)-t, cdbSNP:138184132
complement(1858)-t, cdbSNP:147018763
complement(1884)-, gdbSNP:36014038
complement(1963)-g, adbSNP:141321874
complement(1964)-t, cdbSNP:145588627
complement(1968)-g, adbSNP:150101312
complement(1979)-g, adbSNP:140780596
complement(2042)-g, adbSNP:186596462
complement(2043)-t, cdbSNP:201249884
complement(2050)-t, gdbSNP:150922981
complement(2052)-g, adbSNP:144002108
complement(2067)-t, cdbSNP:139124528
complement(2125)-t, cdbSNP:140386239
complement(2150)-t, cdbSNP:199744753
complement(2166)-dbSNP:
complement(2166)-g, adbSNP:143942399
complement(2178)-t, cdbSNP:201553363
complement(2183)-g, c, adbSNP:140128908
complement(2184)-t, cdbSNP:61731698
complement(2186)-g, adbSNP:61731697
complement(2196..2197)-, ggdbSNP:151237222
complement(2198)-t, cdbSNP:3817466
complement(2209)-dbSNP:
complement(2209)-g, adbSNP:149578114
complement(2323)-dbSNP:
complement(2323)-t, gdbSNP:75643723
complement(2337)-t, g, cdbSNP:140941017
complement(2341)-g, adbSNP:139317911
complement(2363)-c, adbSNP:147295760
complement(2376)-t, cdbSNP:142982382
complement(2427)-g, adbSNP:139078158
complement(2444)-dbSNP:
complement(2444)-g, cdbSNP:147008674
complement(2448..2449)-, cdbSNP:35009667
complement(2529)-c, adbSNP:202241333
complement(2533)-g, adbSNP:142893326
complement(2580)-dbSNP:
complement(2580)-c, adbSNP:116459026
complement(2596)-g, adbSNP:143141379
complement(2597)-t, cdbSNP:190403676
complement(2601)-g, adbSNP:61736460
complement(2607)-t, cdbSNP:151294672
complement(2616)-g, adbSNP:145385312
complement(2620)-g, adbSNP:140230336
complement(2650)-g, adbSNP:146680155
complement(2651)-t, gdbSNP:201195904
complement(2657)-t, cdbSNP:201740894
complement(2658)-t, cdbSNP:200113280
complement(2661)-g, cdbSNP:8096452
complement(2667)-g, adbSNP:139997557
complement(2669)-t, cdbSNP:151082224
complement(2671)-t, cdbSNP:200869858
complement(2680)-t, cdbSNP:200823240
complement(2686)-t, cdbSNP:142911764
complement(2688)-t, cdbSNP:148568579
complement(2691)-c, adbSNP:147480786
complement(2717)-g, adbSNP:143155897
complement(2718)-t, cdbSNP:140662824
complement(2723)-g, adbSNP:199769741
complement(2739)-t, cdbSNP:147247153
complement(2779)-g, adbSNP:142853345
complement(2780)-t, cdbSNP:79015463
complement(2846)-g, adbSNP:192974284
complement(2856)-g, adbSNP:146075320
complement(2892)-t, cdbSNP:200496501
complement(2927)-g, cdbSNP:150175125
complement(2935)-dbSNP:
complement(2935)-t, gdbSNP:61735459
complement(2945)-t, cdbSNP:148045283
complement(2987)-t, cdbSNP:145344390
complement(3001)-g, adbSNP:79592897
complement(3052)-g, adbSNP:138017302
complement(3062)-dbSNP:
complement(3062)-g, adbSNP:116148637
complement(3063)-c, adbSNP:145834920
complement(3077)-t, adbSNP:144613208
complement(3089)-t, g, adbSNP:149824211
complement(3149)-g, adbSNP:202000684
complement(3158)-t, cdbSNP:200474691
complement(3161)-dbSNP:
complement(3161)-g, adbSNP:145398752
complement(3190)-g, adbSNP:150071835
complement(3207)-t, cdbSNP:140548684
complement(3211)-g, adbSNP:147930423
complement(3212)-t, cdbSNP:144676596
complement(3233)-t, adbSNP:1802388
complement(3250)-dbSNP:
complement(3250)-t, cdbSNP:201592629
complement(3280)-t, gdbSNP:190875358
complement(3346)-t, adbSNP:199616331
complement(3347)-t, adbSNP:140830660
complement(3353)-t, gdbSNP:199831654
complement(3440)-dbSNP:
complement(3440)-t, cdbSNP:199863531
complement(3585)-g, adbSNP:11548489
complement(3644)-t, adbSNP:1140830
complement(3810)-g, adbSNP:80008114
complement(3881)-c, adbSNP:187122208
complement(3936)-g, adbSNP:181159929
complement(3950)-t, cdbSNP:73373999
complement(4003)-c, adbSNP:72865098
complement(4023)-t, cdbSNP:141378527
complement(4058)-t, gdbSNP:148690503
complement(4181)-t, adbSNP:9953490
complement(4189)-g, adbSNP:189939395
complement(4311)-c, adbSNP:1140836
complement(4366)-t, cdbSNP:1140837
complement(4372)-g, adbSNP:144097441
complement(4385)-t, cdbSNP:73937119
Gene SymbolEPB41L3
Gene Synonym4.1B; DAL-1; DAL1
Chromosome18
Locus Map18p11.32
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_012307 Homo sapiens erythrocyte membrane protein band 4.1-like 3 (EPB41L3), mRNA. Full Length $1556.10
ORF Sequence $1142.40
Title Loss of expression of the differentially expressed in adenocarcinoma of the lung (DAL-1) protein is associated with metastasis of non-small cell lung carcinoma cells .
Author Zhang,Y., Xu,R., Li,G., Xie,X., Long,J. and Wang,H.
Journal Tumour Biol. 33 (6), 1915-1925 (2012)
Title Aberrant expression of tumor suppressors CADM1 and 4.1B in invasive lesions of primary breast cancer .
Author Takahashi,Y., Iwai,M., Kawai,T., Arakawa,A., Ito,T., Sakurai-Yageta,M., Ito,A., Goto,A., Saito,M., Kasumi,F. and Murakami,Y.
Journal Breast Cancer 19 (3), 242-252 (2012)
Title A four-gene methylation marker panel as triage test in high-risk human papillomavirus positive patients .
Author Eijsink,J.J., Lendvai,A., Deregowski,V., Klip,H.G., Verpooten,G., Dehaspe,L., de Bock,G.H., Hollema,H., van Criekinge,W., Schuuring,E., van der Zee,A.G. and Wisman,G.B.
Journal Int. J. Cancer 130 (8), 1861-1869 (2012)
Title miRNA-223 promotes gastric cancer invasion and metastasis by targeting tumor suppressor EPB41L3 .
Author Li,X., Zhang,Y., Zhang,H., Liu,X., Gong,T., Li,M., Sun,L., Ji,G., Shi,Y., Han,Z., Han,S., Nie,Y., Chen,X., Zhao,Q., Ding,J., Wu,K. and Daiming,F.
Journal Mol. Cancer Res. 9 (7), 824-833 (2011)
Title Structural basis of tumor suppressor in lung cancer 1 (TSLC1) binding to differentially expressed in adenocarcinoma of the lung (DAL-1/4.1B) .
Author Busam,R.D., Thorsell,A.G., Flores,A., Hammarstrom,M., Persson,C., Obrink,B. and Hallberg,B.M.
Journal J. Biol. Chem. 286 (6), 4511-4516 (2011)
Title Loss of DAL-1, a protein 4.1-related tumor suppressor, is an important early event in the pathogenesis of meningiomas .
Author Gutmann,D.H., Donahoe,J., Perry,A., Lemke,N., Gorse,K., Kittiniyom,K., Rempel,S.A., Gutierrez,J.A. and Newsham,I.F.
Journal Hum. Mol. Genet. 9 (10), 1495-1500 (2000)
Title A novel member of the NF2/ERM/4.1 superfamily with growth suppressing properties in lung cancer .
Author Tran,Y.K., Bogler,O., Gorse,K.M., Wieland,I., Green,M.R. and Newsham,I.F.
Journal Cancer Res. 59 (1), 35-43 (1999)
Title Four paralogous protein 4.1 genes map to distinct chromosomes in mouse and human .
Author Peters,L.L., Weier,H.U., Walensky,L.D., Snyder,S.H., Parra,M., Mohandas,N. and Conboy,J.G.
Journal Genomics 54 (2), 348-350 (1998)
Title Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence .
Author Adams,M.D., Kerlavage,A.R., Fleischmann,R.D., Fuldner,R.A., Bult,C.J., Lee,N.H., Kirkness,E.F., Weinstock,K.G., Gocayne,J.D., White,O. et al.
Journal Nature 377 (6547 SUPPL), 3-174 (1995)
Title Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library .
Author Adams,M.D., Soares,M.B., Kerlavage,A.R., Fields,C. and Venter,J.C.
Journal Nat. Genet. 4 (4), 373-380 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878