Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA.
| RefSeq Version | NM_012448.3, 42519913 |
| Length | 5171 bp |
| Structure | linear |
| Update Date | 17-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA. |
| Product | signal transducer and activator of transcription 5B |
| Comment | Summary: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq]. |
| RefSeq | NP_036580.2 |
| CDS | 170..2533 | Exon (1) | 1..159 | Exon (2) | 1..159 | Exon (3) | 160..297 | Exon (4) | 298..454 | Exon (5) | 455..544 | Exon (6) | 545..719 | Exon (7) | 720..850 | Exon (8) | 851..1002 | Exon (9) | 1003..1158 | Exon (10) | 1159..1338 | Exon (11) | 1339..1426 | Exon (12) | 1427..1549 | Exon (13) | 1550..1642 | Exon (14) | 1643..1849 | Exon (15) | 1850..1944 | Exon (16) | 1945..2075 | Exon (17) | 2076..2246 | Exon (18) | 2247..2298 | Exon (19) | 2299..2406 | Exon (20) | 2407..5094 |
| Translation | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(171) | - | g, a | dbSNP:112572423 |
| complement(173) | - | t, c | dbSNP:113461014 |
| complement(250..251) | - | , g | dbSNP:34224133 |
| 558 | + | c, t | dbSNP:2277619 |
| 623 | + | c, t | dbSNP:121908502 |
| complement(638..639) | - | , a | dbSNP:35910895 |
| complement(694) | - | t, c | dbSNP:61755324 |
| complement(795) | - | t, c | dbSNP:28395848 |
| 795 | + | c, t | dbSNP:2230123 |
| 857 | + | c, g | dbSNP:1142942 |
| complement(1162) | - | t, c | dbSNP:59491077 |
| complement(1270) | - | t, g | dbSNP:61749920 |
| complement(1281) | - | t, g | dbSNP:28706683 |
| complement(1346) | - | , t | dbSNP:67333182 |
| complement(1486) | - | , t | dbSNP:67907838 |
| complement(1504) | - | t, c | dbSNP:111880437 |
| complement(1894) | - | g, a | dbSNP:75130700 |
| complement(1933) | - | , a | dbSNP:67295446 |
| 1990 | + | c, g | dbSNP:1065376 |
| 2057 | + | c, g | dbSNP:121908501 |
| 2128 | + | c, t | dbSNP:1057936 |
| complement(2237) | - | )3971s71h( | dbSNP:113693606 |
| complement(2545) | - | g, a | dbSNP:114275908 |
| 2567 | + | c, t | dbSNP:2230097 |
| complement(2595..2779) | - | )2081s71h( | dbSNP:113837988 |
| complement(2599) | - | t, a | dbSNP:77816846 |
| complement(2602) | - | g, a | dbSNP:34320895 |
| complement(2708) | - | (tg)20, 22, 23 | dbSNP:3222523 |
| complement(2718) | - | , ca | dbSNP:111734751 |
| complement(2719) | - | , a | dbSNP:34396327 |
| complement(2720) | - | c, a | dbSNP:68050504 |
| 2720 | + | , g, t | dbSNP:1869364 |
| complement(2720) | - | , caca | dbSNP:57573850 |
| complement(2732..2735) | - | , acac | dbSNP:72204486 |
| complement(2736..2737) | - | , ac | dbSNP:72197660 |
| complement(2743..2746) | - | , caca | dbSNP:72021387 |
| 2744..2745 | + | , gt | dbSNP:3833145 |
| complement(2774) | - | g, a | dbSNP:117921517 |
| complement(2837) | - | t, a | dbSNP:76295584 |
| complement(2842) | - | c, a | dbSNP:78032261 |
| complement(2864) | - | t, c | dbSNP:75341760 |
| complement(2922) | - | c, a | dbSNP:78433343 |
| complement(2925) | - | c, a | dbSNP:76994349 |
| complement(3084) | - | g, a | dbSNP:114475755 |
| complement(3314) | - | t, c | dbSNP:117074548 |
| complement(3427) | - | g, a | dbSNP:113824843 |
| complement(3708) | - | g, a | dbSNP:78682061 |
| complement(3775..3776) | - | , c | dbSNP:35987392 |
| complement(3931) | - | c, a | dbSNP:116244359 |
| complement(4080..4081) | - | , a | dbSNP:34694406 |
| complement(4147) | - | t, c | dbSNP:116906338 |
| complement(4195) | - | g, a | dbSNP:111883304 |
| complement(4222) | - | g, c | dbSNP:112972196 |
| complement(4701) | - | g, a | dbSNP:113234237 |
| complement(4818..4819) | - | , a | dbSNP:71830876 |
| complement(4851) | - | g, c | dbSNP:59138731 |
| complement(4892) | - | g, a | dbSNP:15456 |
| 4960 | + | a, c | dbSNP:1046104 |
| complement(5011) | - | t, g | dbSNP:76069596 |
| Title | The tumor suppressor hTid1 inhibits STAT5b activity via functional interaction . |
| Author | Dhennin-Duthille,I., Nyga,R., Yahiaoui,S., Gouilleux-Gruart,V., Regnier,A., Lassoued,K. and Gouilleux,F. |
| Journal | J. Biol. Chem. 286 (7), 5034-5042 (2011) |
| Title | The role of STAT5 in the development, function, and transformation of B and T lymphocytes . |
| Author | Heltemes-Harris,L.M., Willette,M.J., Vang,K.B. and Farrar,M.A. |
| Journal | Ann. N. Y. Acad. Sci. 1217, 18-31 (2011) |
| Title | ZFP36L1 negatively regulates erythroid differentiation of CD34+ hematopoietic stem cells by interfering with the Stat5b pathway . |
| Author | Vignudelli,T., Selmi,T., Martello,A., Parenti,S., Grande,A., Gemelli,C., Zanocco-Marani,T. and Ferrari,S. |
| Journal | Mol. Biol. Cell 21 (19), 3340-3351 (2010) |
| Title | Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia . |
| Author | Chang,J.S., Wiemels,J.L., Chokkalingam,A.P., Metayer,C., Barcellos,L.F., Hansen,H.M., Aldrich,M.C., Guha,N., Urayama,K.Y., Scelo,G., Green,J., May,S.L., Kiley,V.A., Wiencke,J.K. and Buffler,P.A. |
| Journal | Cancer Epidemiol. Biomarkers Prev. 19 (9), 2152-2163 (2010) |
| Title | STAT5 is critical to maintain effector CD8+ T cell responses . |
| Author | Tripathi,P., Kurtulus,S., Wojciechowski,S., Sholl,A., Hoebe,K., Morris,S.C., Finkelman,F.D., Grimes,H.L. and Hildeman,D.A. |
| Journal | J. Immunol. 185 (4), 2116-2124 (2010) |
| Title | Functional interactions between Stat5 and the glucocorticoid receptor . |
| Author | Stocklin,E., Wissler,M., Gouilleux,F. and Groner,B. |
| Journal | Nature 383 (6602), 726-728 (1996) |
| Title | Formation of STAT5-containing DNA binding complexes in response to colony-stimulating factor-1 and platelet-derived growth factor . |
| Author | Novak,U., Mui,A., Miyajima,A. and Paradiso,L. |
| Journal | J. Biol. Chem. 271 (31), 18350-18354 (1996) |
| Title | Cloning of human Stat5B. Reconstitution of interleukin-2-induced Stat5A and Stat5B DNA binding activity in COS-7 cells . |
| Author | Lin,J.X., Mietz,J., Modi,W.S., John,S. and Leonard,W.J. |
| Journal | J. Biol. Chem. 271 (18), 10738-10744 (1996) |
| Title | Characterization and cloning of STAT5 from IM-9 cells and its activation by growth hormone . |
| Author | Silva,C.M., Lu,H. and Day,R.N. |
| Journal | Mol. Endocrinol. 10 (5), 508-518 (1996) |
| Title | The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15 . |
| Author | Lin,J.X., Migone,T.S., Tsang,M., Friedmann,M., Weatherbee,J.A., Zhou,L., Yamauchi,A., Bloom,E.T., Mietz,J., John,S. et al. |
| Journal | Immunity 2 (4), 331-339 (1995) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |