• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu50618 Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu50618C Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_012448.3, 42519913
Length 2364 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA.
Product signal transducer and activator of transcription 5B
Comment

Summary: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq, Jul 2008].

RefSeq NP_036580.2
CDS 170..2533
Misc Feature(1)164..166
Misc Feature(2)164..166
Misc Feature(3)173..547
Misc Feature(4)173..547
Misc Feature(5)548..550
Misc Feature(6)551..553
Misc Feature(7)581..1159
Misc Feature(8)746..748
Misc Feature(9)863..1132
Misc Feature(10)1163..1918
Misc Feature(11)1886..2320
Misc Feature(12)order(1967..1969,2021..2023,2093..2095,2099..2101)
Misc Feature(13)order(2096..2098,2144..2146)
Misc Feature(14)order(2126..2131,2279..2281)
Misc Feature(15)2204..2206
Misc Feature(16)2264..2266
Misc Feature(17)2264..2266
Misc Feature(18)2264..2266
Misc Feature(19)2264..2266
Misc Feature(20)2342..2344
Misc Feature(21)2360..2362
Misc Feature(22)2387..2389
Misc Feature(23)2396..2398
Exon (1)1..159
Gene:STAT5B
Gene Synonym:STAT5
Exon (2)160..297
Gene:STAT5B
Gene Synonym:STAT5
Exon (3)298..454
Gene:STAT5B
Gene Synonym:STAT5
Exon (4)455..544
Gene:STAT5B
Gene Synonym:STAT5
Exon (5)545..719
Gene:STAT5B
Gene Synonym:STAT5
Exon (6)720..850
Gene:STAT5B
Gene Synonym:STAT5
Exon (7)851..1002
Gene:STAT5B
Gene Synonym:STAT5
Exon (8)1003..1158
Gene:STAT5B
Gene Synonym:STAT5
Exon (9)1159..1338
Gene:STAT5B
Gene Synonym:STAT5
Exon (10)1339..1426
Gene:STAT5B
Gene Synonym:STAT5
Exon (11)1427..1549
Gene:STAT5B
Gene Synonym:STAT5
Exon (12)1550..1642
Gene:STAT5B
Gene Synonym:STAT5
Exon (13)1643..1849
Gene:STAT5B
Gene Synonym:STAT5
Exon (14)1850..1944
Gene:STAT5B
Gene Synonym:STAT5
Exon (15)1945..2075
Gene:STAT5B
Gene Synonym:STAT5
Exon (16)2076..2246
Gene:STAT5B
Gene Synonym:STAT5
Exon (17)2247..2298
Gene:STAT5B
Gene Synonym:STAT5
Exon (18)2299..2406
Gene:STAT5B
Gene Synonym:STAT5
Exon (19)2407..5094
Gene:STAT5B
Gene Synonym:STAT5
Translation MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ WIPHAQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(171)-g, adbSNP:112572423
complement(173)-t, cdbSNP:113461014
complement(176)-t, cdbSNP:144024535
complement(182)-t, adbSNP:376041480
complement(250..251)-, gdbSNP:34224133
complement(324)-dbSNP:
complement(324)-t, adbSNP:139130762
complement(331)-g, adbSNP:201916641
complement(340)-g, adbSNP:200136266
complement(349)-g, cdbSNP:200624718
complement(416)-g, adbSNP:146176992
complement(449)-g, adbSNP:199645527
complement(467)-dbSNP:
complement(467)-g, adbSNP:199894785
complement(539)-t, cdbSNP:374711620
558+dbSNP:
558+c, tdbSNP:2277619
complement(558)-g, adbSNP:386563355
complement(598)-g, cdbSNP:148793995
complement(610)-t, cdbSNP:144367484
623+c, tdbSNP:121908502
complement(624)-t, cdbSNP:149614939
complement(633)-g, adbSNP:138255473
complement(638..639)-, adbSNP:35910895
complement(643)-t, cdbSNP:147066043
complement(651)-t, cdbSNP:200923475
complement(694)-t, cdbSNP:61755324
complement(705)-t, cdbSNP:376439732
complement(732)-dbSNP:
complement(732)-g, adbSNP:143092033
complement(777)-g, adbSNP:139065819
complement(806)-c, adbSNP:377601290
complement(819)-t, cdbSNP:200900246
complement(847)-g, adbSNP:377043175
complement(1032)-dbSNP:
complement(1032)-t, adbSNP:375808218
complement(1038)-t, cdbSNP:376599040
complement(1049)-g, adbSNP:199982340
complement(1087)-g, adbSNP:142321005
complement(1120)-g, adbSNP:372624709
complement(1162)-dbSNP:
complement(1162)-t, cdbSNP:59491077
complement(1227)-t, cdbSNP:143171571
complement(1264)-g, adbSNP:188781721
complement(1270)-t, gdbSNP:61749920
complement(1271)-g, adbSNP:144993426
complement(1281)-t, gdbSNP:28706683
complement(1326)-t, cdbSNP:202077096
complement(1331)-t, cdbSNP:199998167
complement(1333)-g, adbSNP:144060305
complement(1372)-dbSNP:
complement(1372)-g, adbSNP:200710135
complement(1437)-dbSNP:
complement(1437)-t, cdbSNP:373996796
complement(1504)-t, cdbSNP:111880437
complement(1572)-dbSNP:
complement(1572)-g, adbSNP:201911697
complement(1671)-dbSNP:
complement(1671)-t, cdbSNP:146678334
complement(1698)-g, adbSNP:200200711
complement(1720)-g, adbSNP:373036522
complement(1738)-t, cdbSNP:143172354
complement(1750)-t, cdbSNP:140632704
complement(1760)-t, cdbSNP:142918872
complement(1773)-t, cdbSNP:375789837
complement(1813)-g, adbSNP:139437059
complement(1894)-dbSNP:
complement(1894)-g, adbSNP:75130700
complement(1914)-t, cdbSNP:374070270
1990+dbSNP:
1990+c, gdbSNP:1065376
complement(1999)-t, cdbSNP:376254568
complement(2041)-c, adbSNP:144158108
2057+c, gdbSNP:121908501
complement(2075)-t, gdbSNP:367846125
complement(2077)-dbSNP:
complement(2077)-t, cdbSNP:144106094
complement(2096)-g, adbSNP:150697956
2128+c, tdbSNP:1057936
complement(2130)-t, cdbSNP:201246187
complement(2140)-g, adbSNP:141979661
complement(2141)-t, cdbSNP:148568485
complement(2160)-t, gdbSNP:370769279
complement(2164)-g, adbSNP:370257486
complement(2173)-g, adbSNP:147503881
complement(2230)-g, adbSNP:186347987
complement(2253)-dbSNP:
complement(2253)-g, adbSNP:200333924
complement(2259)-t, cdbSNP:200738371
complement(2266)-g, adbSNP:369507540
complement(2308)-dbSNP:
complement(2308)-g, adbSNP:201825895
complement(2323)-g, adbSNP:143157773
complement(2340)-g, adbSNP:139131471
complement(2354)-c, adbSNP:200042237
complement(2384)-g, adbSNP:372734271
complement(2430)-t, cdbSNP:372909572
complement(2434)-t, cdbSNP:368735480
complement(2461)-g, adbSNP:146467656
complement(2493)-t, cdbSNP:138115420
complement(2521)-g, adbSNP:375173590
complement(2535)-g, adbSNP:375927948
complement(2538)-t, cdbSNP:371610966
complement(2545)-g, adbSNP:114275908
2567+c, tdbSNP:2230097
complement(2569)-g, adbSNP:367656244
complement(2602)-g, adbSNP:34320895
complement(2703..2704)-(tg)20, 22, 23dbSNP:3222523
complement(2716..2719)-, acaadbSNP:201167281
complement(2717..2720)-, cacadbSNP:57573850
complement(2717..2718)-, cadbSNP:111734751
complement(2719)-, adbSNP:34396327
complement(2720)-t, gdbSNP:1869364
2744..2745+, gtdbSNP:397840818
complement(2745..2746)-, cadbSNP:146723548
complement(2746..2747)-, cadbSNP:369424383
complement(2757)-g, adbSNP:180927761
complement(2774)-g, adbSNP:190849391
complement(2864)-t, cdbSNP:75341760
complement(2882)-g, adbSNP:143357938
complement(3041)-g, adbSNP:187214937
complement(3084)-g, adbSNP:114475755
complement(3121)-g, adbSNP:181812855
complement(3314)-t, cdbSNP:117074548
3356+c, gdbSNP:139332839
complement(3427)-g, adbSNP:113824843
complement(3428)-t, cdbSNP:146827392
complement(3563)-g, cdbSNP:141028136
complement(3628)-t, adbSNP:148224780
complement(3708)-g, adbSNP:78682061
complement(3730)-t, gdbSNP:190178825
complement(3775..3776)-, cdbSNP:35987392
complement(3817)-g, adbSNP:143058452
complement(3835)-g, adbSNP:376858672
complement(3931)-c, adbSNP:116244359
complement(4070)-t, cdbSNP:184810925
complement(4080..4081)-, adbSNP:34694406
complement(4093)-t, cdbSNP:373852784
complement(4147)-t, cdbSNP:116906338
complement(4175)-t, cdbSNP:149034065
complement(4179)-t, cdbSNP:181312613
complement(4195)-g, adbSNP:111883304
complement(4222)-g, c, adbSNP:112972196
complement(4298)-t, cdbSNP:188617884
complement(4436)-c, adbSNP:146438448
complement(4465)-c, adbSNP:145236827
complement(4510)-t, cdbSNP:183533045
complement(4668)-g, adbSNP:191284679
complement(4679)-g, adbSNP:188882610
complement(4701)-g, adbSNP:113234237
complement(4721)-t, gdbSNP:140444425
complement(4801)-g, adbSNP:185708008
complement(4851)-g, cdbSNP:59138731
4852+c, tdbSNP:146750609
complement(4892)-g, adbSNP:15456
complement(4920)-g, cdbSNP:149725455
4960+a, cdbSNP:1046104
complement(4960)-t, gdbSNP:386513097
complement(5011..5012)-, tdbSNP:373091385
Gene SymbolSTAT5B
Gene SynonymSTAT5
Chromosome17
Locus Map17q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_012448 Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA. On-demand $279.00 12-14
XM_005257625 PREDICTED: Homo sapiens signal transducer and activator of transcription 5B (STAT5B), transcript variant X1, mRNA. On-demand $279.00 12-14
XM_005257626 PREDICTED: Homo sapiens signal transducer and activator of transcription 5B (STAT5B), transcript variant X2, mRNA. On-demand $219.00 7-9
Title Cutaneous T cell lymphoma expresses immunosuppressive CD80 (B7-1) cell surface protein in a STAT5-dependent manner .
Author Zhang Q, Wang HY, Wei F, Liu X, Paterson JC, Roy D, Mihova D, Woetmann A, Ptasznik A, Odum N, Schuster SJ, Marafioti T, Riley JL and Wasik MA.
Journal J. Immunol. 192 (6), 2913-2919 (2014)
Title Constitutive activation of STAT5A and STAT5B regulates IgM secretion in Waldenstrom's macroglobulinemia .
Author Hodge LS, Ziesmer SC, Yang ZZ, Secreto FJ, Novak AJ and Ansell SM.
Journal Blood 123 (7), 1055-1058 (2014)
Title CD82 regulates STAT5/IL-10 and supports survival of acute myelogenous leukemia cells .
Author Nishioka C, Ikezoe T, Yang J, Nobumoto A, Kataoka S, Tsuda M, Udaka
Journal Int. J. Cancer 134 (1), 55-64 (2014)
Title A single nucleotide polymorphism in the STAT5 gene favors colonic as opposed to small-bowel inflammation in Crohn's disease .
Author Connelly TM, Koltun WA, Berg AS, Hegarty JP, Brinton D, Deiling S, Poritz LS and Stewart DB.
Journal Dis. Colon Rectum 56 (9), 1068-1074 (2013)
Title [STAT5B deficiency: a new growth hormone insensitivity syndrome associated to immunological dysfunction] .
Author Scalco RC, Pugliese-Pires PN and Jorge AA.
Journal Arq Bras Endocrinol Metabol 57 (5), 333-338 (2013)
Title Functional interactions between Stat5 and the glucocorticoid receptor .
Author Stocklin E, Wissler M, Gouilleux F and Groner B.
Journal Nature 383 (6602), 726-728 (1996)
Title Formation of STAT5-containing DNA binding complexes in response to colony-stimulating factor-1 and platelet-derived growth factor .
Author Novak U, Mui A, Miyajima A and Paradiso L.
Journal J. Biol. Chem. 271 (31), 18350-18354 (1996)
Title Cloning of human Stat5B. Reconstitution of interleukin-2-induced Stat5A and Stat5B DNA binding activity in COS-7 cells .
Author Lin JX, Mietz J, Modi WS, John S and Leonard WJ.
Journal J. Biol. Chem. 271 (18), 10738-10744 (1996)
Title Characterization and cloning of STAT5 from IM-9 cells and its activation by growth hormone .
Author Silva CM, Lu H and Day RN.
Journal Mol. Endocrinol. 10 (5), 508-518 (1996)
Title The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15 .
Author Lin JX, Migone TS, Tsang M, Friedmann M, Weatherbee JA, Zhou L, Yamauchi A, Bloom ET, Mietz J and John S.
Journal Immunity 2 (4), 331-339 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.