• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA.


RefSeq Accession Definition Services Price Order
NM_012448 Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA. ORF Sequence $685.56
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_012448.3, 42519913
Length 5171 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA.
Product signal transducer and activator of transcription 5B
Comment

Summary: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq, Jul 2008].

RefSeq NP_036580.2
CDS 170..2533
Misc Feature(1)164..166
Misc Feature(2)164..166
Misc Feature(3)173..544
Misc Feature(4)173..544
Misc Feature(5)548..550
Misc Feature(6)551..553
Misc Feature(7)581..1159
Misc Feature(8)746..748
Misc Feature(9)863..1132
Misc Feature(10)1163..1918
Misc Feature(11)1886..2320
Misc Feature(12)order(1967..1969,2021..2023,2093..2095,2099..2101)
Misc Feature(13)order(2096..2098,2144..2146)
Misc Feature(14)order(2126..2131,2279..2281)
Misc Feature(15)2204..2206
Misc Feature(16)2264..2266
Misc Feature(17)2264..2266
Misc Feature(18)2264..2266
Misc Feature(19)2264..2266
Misc Feature(20)2342..2344
Misc Feature(21)2360..2362
Misc Feature(22)2387..2389
Misc Feature(23)2396..2398
Exon (1)1..159
Gene:STAT5B
Gene Synonym:STAT5
Exon (2)160..297
Gene:STAT5B
Gene Synonym:STAT5
Exon (3)298..454
Gene:STAT5B
Gene Synonym:STAT5
Exon (4)455..544
Gene:STAT5B
Gene Synonym:STAT5
Exon (5)545..719
Gene:STAT5B
Gene Synonym:STAT5
Exon (6)720..850
Gene:STAT5B
Gene Synonym:STAT5
Exon (7)851..1002
Gene:STAT5B
Gene Synonym:STAT5
Exon (8)1003..1158
Gene:STAT5B
Gene Synonym:STAT5
Exon (9)1159..1338
Gene:STAT5B
Gene Synonym:STAT5
Exon (10)1339..1426
Gene:STAT5B
Gene Synonym:STAT5
Exon (11)1427..1549
Gene:STAT5B
Gene Synonym:STAT5
Exon (12)1550..1642
Gene:STAT5B
Gene Synonym:STAT5
Exon (13)1643..1849
Gene:STAT5B
Gene Synonym:STAT5
Exon (14)1850..1944
Gene:STAT5B
Gene Synonym:STAT5
Exon (15)1945..2075
Gene:STAT5B
Gene Synonym:STAT5
Exon (16)2076..2246
Gene:STAT5B
Gene Synonym:STAT5
Exon (17)2247..2298
Gene:STAT5B
Gene Synonym:STAT5
Exon (18)2299..2406
Gene:STAT5B
Gene Synonym:STAT5
Exon (19)2407..5094
Gene:STAT5B
Gene Synonym:STAT5
Translation MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ WIPHAQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(171)-g, adbSNP:112572423
complement(173)-t, cdbSNP:113461014
complement(176)-t, cdbSNP:144024535
complement(250..251)-, gdbSNP:34224133
complement(324)-dbSNP:
complement(324)-t, adbSNP:139130762
complement(331)-g, adbSNP:201916641
complement(340)-g, adbSNP:200136266
complement(349)-g, cdbSNP:200624718
complement(416)-g, adbSNP:146176992
complement(449)-g, adbSNP:199645527
complement(467)-dbSNP:
complement(467)-g, adbSNP:199894785
complement(499)-t, gdbSNP:142297734
complement(558)-dbSNP:
complement(558)-t, cdbSNP:2277619
complement(598)-g, cdbSNP:148793995
complement(610)-t, cdbSNP:144367484
complement(623)-t, cdbSNP:121908502
complement(624)-t, cdbSNP:149614939
complement(633)-g, adbSNP:138255473
complement(638..639)-, adbSNP:35910895
complement(643)-t, cdbSNP:147066043
complement(651)-t, cdbSNP:200923475
complement(694)-t, cdbSNP:61755324
complement(732)-dbSNP:
complement(732)-g, adbSNP:143092033
complement(777)-g, adbSNP:139065819
complement(819)-t, cdbSNP:200900246
complement(1013)-dbSNP:
complement(1013)-g, adbSNP:146356053
complement(1049)-g, adbSNP:199982340
complement(1087)-g, adbSNP:142321005
complement(1162)-dbSNP:
complement(1162)-t, cdbSNP:59491077
complement(1227)-t, cdbSNP:143171571
complement(1264)-g, adbSNP:188781721
complement(1270)-t, gdbSNP:61749920
complement(1271)-g, adbSNP:144993426
complement(1281)-t, gdbSNP:28706683
complement(1326)-t, cdbSNP:202077096
complement(1331)-t, cdbSNP:199998167
complement(1333)-g, adbSNP:144060305
complement(1346)-dbSNP:
complement(1346)-, tdbSNP:67333182
complement(1372)-g, adbSNP:200710135
complement(1486)-dbSNP:
complement(1486)-, tdbSNP:67907838
complement(1504)-t, cdbSNP:111880437
complement(1572)-dbSNP:
complement(1572)-g, adbSNP:201911697
complement(1671)-dbSNP:
complement(1671)-t, cdbSNP:146678334
complement(1698)-g, adbSNP:200200711
complement(1738)-t, cdbSNP:143172354
complement(1750)-t, cdbSNP:140632704
complement(1760)-t, cdbSNP:142918872
complement(1813)-g, adbSNP:139437059
complement(1894)-dbSNP:
complement(1894)-g, adbSNP:75130700
complement(1934)-, adbSNP:67295446
complement(1990)-dbSNP:
complement(1990)-g, cdbSNP:1065376
complement(2041)-c, adbSNP:144158108
complement(2057)-g, cdbSNP:121908501
complement(2077)-dbSNP:
complement(2077)-t, cdbSNP:144106094
complement(2096)-g, adbSNP:150697956
complement(2128)-t, cdbSNP:1057936
complement(2130)-t, cdbSNP:201246187
complement(2140)-g, adbSNP:141979661
complement(2141)-t, cdbSNP:148568485
complement(2173)-g, adbSNP:147503881
complement(2230)-g, adbSNP:186347987
complement(2253)-dbSNP:
complement(2253)-g, adbSNP:200333924
complement(2259)-t, cdbSNP:200738371
complement(2308)-dbSNP:
complement(2308)-g, adbSNP:201825895
complement(2323)-g, adbSNP:143157773
complement(2340)-g, adbSNP:139131471
complement(2354)-c, adbSNP:200042237
complement(2461)-g, adbSNP:146467656
complement(2493)-t, cdbSNP:138115420
complement(2545)-g, adbSNP:114275908
complement(2567)-t, cdbSNP:2230097
complement(2602)-g, adbSNP:34320895
complement(2716..2719)-, acaadbSNP:201167281
complement(2719)-, adbSNP:34396327
complement(2720)-t, gdbSNP:1869364
complement(2740..2743)-, acacdbSNP:72204486
complement(2743..2746)-, cacadbSNP:72021387
complement(2744..2745)-, gtdbSNP:3833145
complement(2744)-, cacadbSNP:57573850
complement(2745..2746)-, cadbSNP:146723548
complement(2746)-, cadbSNP:111734751
complement(2757)-g, adbSNP:180927761
complement(2774)-g, adbSNP:190849391
complement(2864)-t, cdbSNP:75341760
complement(2882)-g, adbSNP:143357938
complement(3041)-g, adbSNP:187214937
complement(3084)-g, adbSNP:114475755
complement(3121)-g, adbSNP:181812855
complement(3314)-t, cdbSNP:117074548
complement(3356)-g, cdbSNP:139332839
complement(3427)-g, adbSNP:113824843
complement(3428)-t, cdbSNP:146827392
complement(3563)-g, cdbSNP:141028136
complement(3628)-t, adbSNP:148224780
complement(3708)-g, adbSNP:78682061
complement(3730)-t, gdbSNP:190178825
complement(3778..3779)-, cdbSNP:35987392
complement(3817)-g, adbSNP:143058452
complement(3931)-c, adbSNP:116244359
complement(4070)-t, cdbSNP:184810925
complement(4083..4084)-, adbSNP:34694406
complement(4147)-t, cdbSNP:116906338
complement(4175)-t, cdbSNP:149034065
complement(4179)-t, cdbSNP:181312613
complement(4195)-g, adbSNP:111883304
complement(4222)-g, c, adbSNP:112972196
complement(4298)-t, cdbSNP:188617884
complement(4436)-c, adbSNP:146438448
complement(4465)-c, adbSNP:145236827
complement(4510)-t, cdbSNP:183533045
complement(4668)-g, adbSNP:191284679
complement(4679)-g, adbSNP:188882610
complement(4701)-g, adbSNP:113234237
complement(4721)-t, gdbSNP:140444425
complement(4801)-g, adbSNP:185708008
complement(4824..4825)-, adbSNP:71830876
complement(4851)-g, cdbSNP:59138731
complement(4852)-t, cdbSNP:146750609
complement(4892)-g, adbSNP:15456
complement(4920)-g, cdbSNP:149725455
complement(4960)-c, adbSNP:1046104
Gene SymbolSTAT5B
Gene SynonymSTAT5
Chromosome17
Locus Map17q11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_012448 Homo sapiens signal transducer and activator of transcription 5B (STAT5B), mRNA. Full Length $2326.95
ORF Sequence $685.56
Title No association between the STAT5b rs6503691 (C>T) SNP and myeloproliferative neoplasms .
Author Trifa,A.P., Cucuianu,A., Popp,R.A., Coada,C.A., Costache,R.M., Sarca,A.D., Farcas,M.F., Militaru,M.S. and Pop,I.V.
Journal Eur. J. Haematol. 90 (3), 257-258 (2013)
Title Definitive evidence using enucleated cytoplasts for a nongenomic basis for the cystic change in endoplasmic reticulum structure caused by STAT5a/b siRNAs .
Author Lee,J.E., Yang,Y.M., Yuan,H. and Sehgal,P.B.
Journal Am. J. Physiol., Cell Physiol. 304 (4), C312-C323 (2013)
Title STAT5 is crucial to maintain leukemic stem cells in acute myelogenous leukemias induced by MOZ-TIF2 .
Author Tam,W.F., Hahnel,P.S., Schuler,A., Lee,B.H., Okabe,R., Zhu,N., Pante,S.V., Raffel,G., Mercher,T., Wernig,G., Bockamp,E., Sasca,D., Kreft,A., Robinson,G.W., Hennighausen,L., Gilliland,D.G. and Kindler,T.
Journal Cancer Res. 73 (1), 373-384 (2013)
Title Orphan nuclear receptor small heterodimer partner negatively regulates growth hormone-mediated induction of hepatic gluconeogenesis through inhibition of signal transducer and activator of transcription 5 (STAT5) transactivation .
Author Kim,Y.D., Li,T., Ahn,S.W., Kim,D.K., Lee,J.M., Hwang,S.L., Kim,Y.H., Lee,C.H., Lee,I.K., Chiang,J.Y. and Choi,H.S.
Journal J. Biol. Chem. 287 (44), 37098-37108 (2012)
Title STAT5b as molecular target in pancreatic cancer--inhibition of tumor growth, angiogenesis, and metastases .
Author Moser,C., Ruemmele,P., Gehmert,S., Schenk,H., Kreutz,M.P., Mycielska,M.E., Hackl,C., Kroemer,A., Schnitzbauer,A.A., Stoeltzing,O., Schlitt,H.J., Geissler,E.K. and Lang,S.A.
Journal Neoplasia 14 (10), 915-925 (2012)
Title Functional interactions between Stat5 and the glucocorticoid receptor .
Author Stocklin,E., Wissler,M., Gouilleux,F. and Groner,B.
Journal Nature 383 (6602), 726-728 (1996)
Title Formation of STAT5-containing DNA binding complexes in response to colony-stimulating factor-1 and platelet-derived growth factor .
Author Novak,U., Mui,A., Miyajima,A. and Paradiso,L.
Journal J. Biol. Chem. 271 (31), 18350-18354 (1996)
Title Cloning of human Stat5B. Reconstitution of interleukin-2-induced Stat5A and Stat5B DNA binding activity in COS-7 cells .
Author Lin,J.X., Mietz,J., Modi,W.S., John,S. and Leonard,W.J.
Journal J. Biol. Chem. 271 (18), 10738-10744 (1996)
Title Characterization and cloning of STAT5 from IM-9 cells and its activation by growth hormone .
Author Silva,C.M., Lu,H. and Day,R.N.
Journal Mol. Endocrinol. 10 (5), 508-518 (1996)
Title The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15 .
Author Lin,J.X., Migone,T.S., Tsang,M., Friedmann,M., Weatherbee,J.A., Zhou,L., Yamauchi,A., Bloom,E.T., Mietz,J., John,S. et al.
Journal Immunity 2 (4), 331-339 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878