• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_012452 Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_012452.2, 23238205
Length 1377 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA.
Product tumor necrosis factor receptor superfamily member 13B
Comment

Summary: The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008].

RefSeq NP_036584.1
CDS 14..895
Misc Feature(1)8..10
Misc Feature(2)8..10
Misc Feature(3)113..211
Misc Feature(4)113..211
Misc Feature(5)218..340
Misc Feature(6)224..325
Misc Feature(7)509..571
Misc Feature(8)512..571
Exon (1)75..212
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; RYZN; TACI; TNFRSF14B
Exon (2)213..458
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; RYZN; TACI; TNFRSF14B
Exon (3)459..644
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; RYZN; TACI; TNFRSF14B
Exon (4)645..1358
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; RYZN; TACI; TNFRSF14B
Translation MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR QRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLV AVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAP TQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(21)-t, cdbSNP:201599964
complement(53)-g, adbSNP:370503383
complement(54)-c, adbSNP:200309474
complement(71)-g, adbSNP:200013015
complement(94)-dbSNP:
complement(94)-t, cdbSNP:8072293
complement(104)-t, cdbSNP:368391092
complement(118)-g, adbSNP:200868537
complement(119)-t, cdbSNP:143099385
complement(125)-g, adbSNP:147891155
131+c, tdbSNP:72553874
134+c, gdbSNP:67951770
134+, gdbSNP:67951769
complement(139)-g, adbSNP:377551435
complement(145)-t, cdbSNP:200936104
complement(158)-g, adbSNP:374547688
complement(184)-g, cdbSNP:149084717
complement(192)-t, cdbSNP:373134429
complement(204)-g, cdbSNP:145002378
complement(211)-t, gdbSNP:144718007
217..218+dbSNP:
217..218+, adbSNP:72553875
complement(227)-g, adbSNP:375514495
complement(228)-t, cdbSNP:55916807
complement(231..232)-, cdbSNP:34182967
complement(239)-c, adbSNP:146436713
complement(244)-t, cdbSNP:371317735
249+a, gdbSNP:72553876
273+a, tdbSNP:72553877
complement(288)-t, adbSNP:368250378
complement(293)-t, cdbSNP:200612226
complement(304)-t, gdbSNP:35062843
310..311+, tdbSNP:72553878
complement(312)-t, cdbSNP:75885572
324+a, gdbSNP:72553879
complement(342)-c, adbSNP:150848825
complement(370)-t, cdbSNP:374322117
complement(377)-g, adbSNP:201124889
complement(412)-t, cdbSNP:371292644
complement(428)-g, adbSNP:141494621
complement(431)-t, cdbSNP:199578237
444+a, cdbSNP:104894650
complement(456)-g, adbSNP:200173159
458+a, gdbSNP:72553880
complement(465)-dbSNP:
complement(465)-g, adbSNP:200037919
468+a, gdbSNP:72553881
complement(481)-c, adbSNP:148758686
505+a, c, gdbSNP:72553882
complement(525)-c, adbSNP:143027621
complement(530)-t, cdbSNP:369937497
complement(532)-g, adbSNP:151139237
complement(533)-c, adbSNP:375396272
544+c, tdbSNP:34088818
complement(548)-g, adbSNP:145912877
complement(574)-t, cdbSNP:373469090
complement(576..578)-, tctdbSNP:376630110
complement(576)-t, adbSNP:74811083
complement(579)-c, adbSNP:199777698
complement(580)-c, adbSNP:370856157
complement(581)-t, g, cdbSNP:150101848
complement(583)-t, cdbSNP:199810075
584..585+, gdbSNP:72553884
592+a, cdbSNP:72553885
594..595+cc, ggdbSNP:121908379
complement(601)-c, adbSNP:56248318
complement(605)-g, adbSNP:140781824
complement(606)-t, cdbSNP:150974807
complement(613)-t, cdbSNP:371989142
complement(617)-g, adbSNP:143562358
complement(627)-g, adbSNP:201068309
complement(631)-g, adbSNP:147846226
complement(646)-dbSNP:
complement(646)-g, adbSNP:199592890
complement(650)-t, cdbSNP:140914723
complement(654)-g, adbSNP:144560464
complement(672)-g, adbSNP:56063729
complement(686)-t, cdbSNP:368290908
complement(696)-t, gdbSNP:201886192
complement(706)-g, cdbSNP:145711865
complement(719)-c, adbSNP:201021960
complement(729)-g, adbSNP:375891337
complement(730)-t, cdbSNP:199603343
complement(735)-g, adbSNP:370250196
complement(745)-g, adbSNP:371893711
complement(746)-t, cdbSNP:372816963
749+g, tdbSNP:72553886
complement(753)-g, adbSNP:149635611
765+c, tdbSNP:34562254
complement(766)-g, adbSNP:367583089
complement(767)-t, cdbSNP:111439115
complement(771)-g, cdbSNP:191731200
complement(792)-t, cdbSNP:150660451
complement(826)-g, adbSNP:200924433
complement(841)-g, cdbSNP:144383122
complement(844)-g, adbSNP:11078355
complement(851)-g, cdbSNP:374957601
complement(854)-t, cdbSNP:201451843
complement(884)-g, adbSNP:146392507
complement(886)-t, cdbSNP:370631317
complement(897)-g, adbSNP:142248746
complement(932)-g, adbSNP:188626884
complement(936)-t, cdbSNP:369550819
complement(938)-c, adbSNP:377155942
complement(980..982)-, catdbSNP:374314027
complement(981..983)-, tcadbSNP:150068036
complement(985..987)-, ctcdbSNP:199572305
complement(1027)-t, cdbSNP:183446665
complement(1068)-t, cdbSNP:56153623
complement(1095)-g, cdbSNP:373632897
complement(1248)-t, gdbSNP:56059714
complement(1284)-g, adbSNP:71362290
complement(1287)-t, cdbSNP:190709636
complement(1309)-t, cdbSNP:55701306
Gene SymbolTNFRSF13B
Gene SynonymCD267; CVID; CVID2; RYZN; TACI; TNFRSF14B
Chromosome17
Locus Map17p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_012452 Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA. In-stock $348.00 $299.00 10
Title Genome-wide association study of lung function phenotypes in a founder population .
Author Yao TC, Du G, Han L, Sun Y, Hu D, Yang JJ, Mathias R, Roth LA, Rafaels N, Thompson EE, Loisel DA, Anderson R, Eng C, Arruabarrena Orbegozo M, Young M, Klocksieben JM, Anderson E, Shanovich K, Lester LA, Williams LK, Barnes KC, Burchard EG, Nicolae DL, Abney M and Ober C.
Journal J. Allergy Clin. Immunol. 133 (1), 248-255 (2014)
Title CVID-associated TACI mutations affect autoreactive B cell selection and activation .
Author Romberg,N., Chamberlain,N., Saadoun,D., Gentile,M., Kinnunen,T., Ng,Y.S., Virdee,M., Menard,L., Cantaert,T., Morbach,H., Rachid,R., Martinez-Pomar,N., Matamoros,N., Geha,R., Grimbacher,B., Cerutti,A., Cunningham-Rundles,C. and Meffre,E.
Journal J. Clin. Invest. 123 (10), 4283-4293 (2013)
Title Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk .
Author Chubb D, Weinhold N, Broderick P, Chen B, Johnson DC, Forsti A, Vijayakrishnan J, Migliorini G, Dobbins SE, Holroyd A, Hose D, Walker BA, Davies FE, Gregory WA, Jackson GH, Irving JA, Pratt G, Fegan C, Fenton JA, Neben K, Hoffmann P, Nothen MM, Muhleisen TW, Eisele L, Ross FM, Straka C, Einsele H, Langer C, Dorner E, Allan JM, Jauch A, Morgan GJ, Hemminki K, Houlston RS and Goldschmidt H.
Journal Nat. Genet. 45 (10), 1221-1225 (2013)
Title No evidence that soluble TACI induces signalling via membrane-expressed BAFF and APRIL in myeloid cells .
Author Nys J, Smulski CR, Tardivel A, Willen L, Kowalczyk C, Donze O, Huard B, Hess H and Schneider P.
Journal PLoS ONE 8 (4), E61350 (2013)
Title Heterozygous alterations of TNFRSF13B/TACI in tonsillar hypertrophy and sarcoidosis .
Author Speletas M, Salzer U, Florou Z, Petinaki E, Daniil Z, Bardaka F, Gourgoulianis KI, Skoulakis C and Germenis AE.
Journal Clin. Dev. Immunol. 2013, 532437 (2013)
Title TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation .
Author Xia XZ, Treanor J, Senaldi G, Khare SD, Boone T, Kelley M, Theill LE, Colombero A, Solovyev I, Lee F, McCabe S, Elliott R, Miner K, Hawkins N, Guo J, Stolina M, Yu G, Wang J, Delaney J, Meng SY, Boyle WJ and Hsu H.
Journal J. Exp. Med. 192 (1), 137-143 (2000)
Title Identification of a receptor for BLyS demonstrates a crucial role in humoral immunity .
Author Yan M, Marsters SA, Grewal IS, Wang H, Ashkenazi A and Dixit VM.
Journal Nat. Immunol. 1 (1), 37-41 (2000)
Title TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease .
Author Gross JA, Johnston J, Mudri S, Enselman R, Dillon SR, Madden K, Xu W, Parrish-Novak J, Foster D, Lofton-Day C, Moore M, Littau A, Grossman A, Haugen H, Foley K, Blumberg H, Harrison K, Kindsvogel W and Clegg CH.
Journal Nature 404 (6781), 995-999 (2000)
Title NF-AT activation induced by a CAML-interacting member of the tumor necrosis factor receptor superfamily .
Author von Bulow GU and Bram RJ.
Journal Science 278 (5335), 138-141 (1997)
Title Common Variable Immune Deficiency Overview .
Author Scharenberg,A.M., Hannibal,M.C., Torgerson,T., Ochs,H.D. and Rawlings,D.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.