• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA.


RefSeq Accession Definition Services Price Order
NM_012452 Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA. ORF Sequence $255.78
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_012452.2, 23238205
Length 1377 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA.
Product tumor necrosis factor receptor superfamily member 13B
Comment

Summary: The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008].

RefSeq NP_036584.1
CDS 14..895
Misc Feature(1)8..10
Misc Feature(2)8..10
Misc Feature(3)113..211
Misc Feature(4)113..211
Misc Feature(5)218..340
Misc Feature(6)224..325
Misc Feature(7)509..571
Misc Feature(8)512..571
Exon (1)75..212
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; TACI; TNFRSF14B
Exon (2)213..458
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; TACI; TNFRSF14B
Exon (3)459..644
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; TACI; TNFRSF14B
Exon (4)645..1358
Gene:TNFRSF13B
Gene Synonym:CD267; CVID; CVID2; TACI; TNFRSF14B
Translation MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR QRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLV AVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAP TQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(21)-t, cdbSNP:201599964
complement(54)-c, adbSNP:200309474
complement(71)-g, adbSNP:200013015
complement(94)-dbSNP:
complement(94)-t, cdbSNP:8072293
complement(118)-g, adbSNP:200868537
complement(119)-t, cdbSNP:143099385
complement(125)-g, adbSNP:147891155
complement(131)-t, cdbSNP:72553874
complement(134)-, gdbSNP:67951769
complement(134)-g, cdbSNP:67951770
complement(145)-t, cdbSNP:200936104
complement(184)-g, cdbSNP:149084717
complement(204)-g, cdbSNP:145002378
complement(211)-t, gdbSNP:144718007
complement(217..218)-dbSNP:
complement(217..218)-, adbSNP:72553875
complement(228)-t, cdbSNP:55916807
complement(232..233)-, cdbSNP:34182967
complement(239)-c, adbSNP:146436713
complement(249)-g, adbSNP:72553876
complement(273)-t, adbSNP:72553877
complement(293)-t, cdbSNP:200612226
complement(304)-t, gdbSNP:35062843
complement(310..311)-, tdbSNP:72553878
complement(312)-t, cdbSNP:75885572
complement(323)-t, cdbSNP:34557412
complement(324)-g, adbSNP:72553879
complement(342)-c, adbSNP:150848825
complement(377)-g, adbSNP:201124889
complement(428)-g, adbSNP:141494621
complement(431)-t, cdbSNP:199578237
complement(444)-c, adbSNP:104894650
complement(456)-g, adbSNP:200173159
complement(458)-g, adbSNP:72553880
complement(465)-dbSNP:
complement(465)-g, adbSNP:200037919
complement(468)-g, adbSNP:72553881
complement(481)-c, adbSNP:148758686
complement(505)-g, c, adbSNP:72553882
complement(525)-c, adbSNP:143027621
complement(532)-g, adbSNP:151139237
complement(544)-t, cdbSNP:34088818
complement(548)-g, adbSNP:145912877
complement(555)-c, adbSNP:72553883
complement(576)-t, adbSNP:74811083
complement(579)-c, adbSNP:199777698
complement(581)-t, g, cdbSNP:150101848
complement(583)-t, cdbSNP:199810075
complement(584..585)-, gdbSNP:72553884
complement(592)-c, adbSNP:72553885
complement(594..595)-gg, ccdbSNP:121908379
complement(601)-c, adbSNP:56248318
complement(605)-g, adbSNP:140781824
complement(606)-t, cdbSNP:150974807
complement(617)-g, adbSNP:143562358
complement(618)-g, adbSNP:104894649
complement(627)-g, adbSNP:201068309
complement(631)-g, adbSNP:147846226
complement(646)-dbSNP:
complement(646)-g, adbSNP:199592890
complement(650)-t, cdbSNP:140914723
complement(654)-g, adbSNP:144560464
complement(672)-g, adbSNP:56063729
complement(696)-t, gdbSNP:201886192
complement(706)-g, cdbSNP:145711865
complement(719)-c, adbSNP:201021960
complement(730)-t, cdbSNP:199603343
complement(749)-t, gdbSNP:72553886
complement(753)-g, adbSNP:149635611
complement(765)-t, cdbSNP:34562254
complement(767)-t, cdbSNP:111439115
complement(771)-g, cdbSNP:191731200
complement(792)-t, cdbSNP:150660451
complement(826)-g, adbSNP:200924433
complement(841)-g, cdbSNP:144383122
complement(844)-g, adbSNP:11078355
complement(854)-t, cdbSNP:201451843
complement(884)-g, adbSNP:146392507
complement(897)-g, adbSNP:142248746
complement(932)-g, adbSNP:188626884
complement(980..982)-, catdbSNP:56374236
complement(981..983)-, tcadbSNP:150068036
complement(981)-, tcadbSNP:112391125
complement(985..987)-, ctcdbSNP:199572305
complement(1027)-t, cdbSNP:183446665
complement(1068)-t, cdbSNP:56153623
complement(1248)-t, gdbSNP:56059714
complement(1284)-g, adbSNP:71362290
complement(1287)-t, cdbSNP:190709636
complement(1309)-t, cdbSNP:55701306
Gene SymbolTNFRSF13B
Gene SynonymCD267; CVID; CVID2; TACI; TNFRSF14B
Chromosome17
Locus Map17p11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_012452 Homo sapiens tumor necrosis factor receptor superfamily, member 13B (TNFRSF13B), mRNA. Full Length $399.33
ORF Sequence $255.78
Title Clinical variability of family members with the C104R mutation in transmembrane activator and calcium modulator and cyclophilin ligand interactor (TACI) .
Author Koopmans,W., Woon,S.T., Brooks,A.E., Dunbar,P.R., Browett,P. and Ameratunga,R.
Journal J. Clin. Immunol. 33 (1), 68-73 (2013)
Title Genome-wide association study identifies common variants at TNFRSF13B associated with IgG level in a healthy Chinese male population .
Author Liao,M., Ye,F., Zhang,B., Huang,L., Xiao,Q., Qin,M., Mo,L., Tan,A., Gao,Y., Lu,Z., Wu,C., Zhang,Y., Zhang,H., Qin,X., Hu,Y., Yang,X. and Mo,Z.
Journal Genes Immun. 13 (6), 509-513 (2012)
Title A novel compound heterozygous TACI mutation in an autosomal recessive common variable immunodeficiency (CVID) family .
Author Lougaris,V., Gallizzi,R., Vitali,M., Baronio,M., Salpietro,A., Bergbreiter,A., Salzer,U., Badolato,R. and Plebani,A.
Journal Hum. Immunol. 73 (8), 836-839 (2012)
Title The impact of TACI mutations: from hypogammaglobulinemia in infancy to autoimmunity in adulthood .
Author Barroeta Seijas,A.B., Graziani,S., Cancrini,C., Finocchi,A., Ferrari,S., Miniero,R., Conti,F., Zuntini,R., Chini,L., Chiarello,P., Bengala,M., Rossi,P., Moschese,V. and Di Matteo,G.
Journal Int J Immunopathol Pharmacol 25 (2), 407-414 (2012)
Title Association of common variants in TNFRSF13B, TNFSF13, and ANXA3 with serum levels of non-albumin protein and immunoglobulin isotypes in Japanese .
Author Osman,W., Okada,Y., Kamatani,Y., Kubo,M., Matsuda,K. and Nakamura,Y.
Journal PLoS ONE 7 (4), E32683 (2012)
Title TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation .
Author Xia,X.Z., Treanor,J., Senaldi,G., Khare,S.D., Boone,T., Kelley,M., Theill,L.E., Colombero,A., Solovyev,I., Lee,F., McCabe,S., Elliott,R., Miner,K., Hawkins,N., Guo,J., Stolina,M., Yu,G., Wang,J., Delaney,J., Meng,S.Y., Boyle,W.J. and Hsu,H.
Journal J. Exp. Med. 192 (1), 137-143 (2000)
Title Identification of a receptor for BLyS demonstrates a crucial role in humoral immunity .
Author Yan,M., Marsters,S.A., Grewal,I.S., Wang,H., Ashkenazi,A. and Dixit,V.M.
Journal Nat. Immunol. 1 (1), 37-41 (2000)
Title Interaction of the TNF homologues BLyS and APRIL with the TNF receptor homologues BCMA and TACI .
Author Marsters,S.A., Yan,M., Pitti,R.M., Haas,P.E., Dixit,V.M. and Ashkenazi,A.
Journal Curr. Biol. 10 (13), 785-788 (2000)
Title TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease .
Author Gross,J.A., Johnston,J., Mudri,S., Enselman,R., Dillon,S.R., Madden,K., Xu,W., Parrish-Novak,J., Foster,D., Lofton-Day,C., Moore,M., Littau,A., Grossman,A., Haugen,H., Foley,K., Blumberg,H., Harrison,K., Kindsvogel,W. and Clegg,C.H.
Journal Nature 404 (6781), 995-999 (2000)
Title NF-AT activation induced by a CAML-interacting member of the tumor necrosis factor receptor superfamily .
Author von Bulow,G.U. and Bram,R.J.
Journal Science 278 (5335), 138-141 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878