|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Rattus norvegicus cortistatin (Cort), mRNA.
| RefSeq Version | NM_012835.1, 6978682 |
| Length | 438 bp |
| Structure | linear |
| Update Date | 21-FEB-2010 |
| Organism | Rattus norvegicus (Norway rat) |
| Definition | Rattus norvegicus cortistatin (Cort), mRNA. |
| Product | cortistatin precursor |
| Comment | Summary: inhibits growth hormone secretion; may act as a neuropeptide to mediate signaling via a somatostatin receptor subtype [RGD]. |
| RefSeq | NP_036967.1 |
| CDS | 30..368 |
| Translation | MGGCSTRGKRPSALSLLLLLLLSGIAASALPLESGPTGQDSVQDATGGRRTGLLTFLAWW
HEWASQDSSSTAFEGGTPELSKRQERPPLQQPPHRDKKPCKNFFWKTFSSCK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Title | RT-PCR and immunocytochemistry studies support the presence of somatostatin, cortistatin and somatostatin receptor subtypes in rat Kupffer cells . |
| Author | Xidakis,C., Mastrodimou,N., Notas,G., Renieri,E., Kolios,G., Kouroumalis,E. and Thermos,K. |
| Journal | Regul. Pept. 143 (1-3), 76-82 (2007) |
| Title | Cortistatin promotes and negatively correlates with slow-wave sleep . |
| Author | Bourgin,P., Fabre,V., Huitron-Resendiz,S., Henriksen,S.J., Prospero-Garcia,O., Criado,J.R. and de Lecea,L. |
| Journal | Eur. J. Neurosci. 26 (3), 729-738 (2007) |
| Title | Growth hormone-inhibiting activity of cortistatin in the rat . |
| Author | Deghenghi,R., Avallone,R., Torsello,A., Muccioli,G., Ghigo,E. and Locatelli,V. |
| Journal | J. Endocrinol. Invest. 24 (11), RC31-RC33 (2001) |
| Title | A cortical neuropeptide with neuronal depressant and sleep-modulating properties . |
| Author | de Lecea,L., Criado,J.R., Prospero-Garcia,O., Gautvik,K.M., Schweitzer,P., Danielson,P.E., Dunlop,C.L., Siggins,G.R., Henriksen,S.J. and Sutcliffe,J.G. |
| Journal | Nature 381 (6579), 242-245 (1996) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |