• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22082 Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand TBD -1
OHu22082C Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA. Customized vector On-demand TBD -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_013227.3, 256017256
Length 7593 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA.
Product aggrecan core protein isoform 2 precursor
Comment

Summary: This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) represents the longer transcript and it encodes the longer protein (isoform 2). Isoform 2 contains an EGF-like and a CRP-like domain in the C-terminus.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_037359.3
CDS 375..7967
Misc Feature(1)369..371
Misc Feature(2)369..371
Misc Feature(3)480..824
Misc Feature(4)501..836
Misc Feature(5)831..1115
Misc Feature(6)861..866
Misc Feature(7)1134..1421
Misc Feature(8)1155..1160
Misc Feature(9)1806..2090
Misc Feature(10)1836..1841
Misc Feature(11)2109..2396
Misc Feature(12)2130..2135
Misc Feature(13)7221..7313
Misc Feature(14)7332..7703
Misc Feature(15)order(7386..7388,7482..7493,7578..7580,7608..7610,
Misc Feature(16)order(7515..7517,7527..7529,7596..7598,7614..7619)
Misc Feature(17)order(7527..7529,7617..7619)
Misc Feature(18)order(7587..7589,7593..7595,7614..7616,7656..7661)
Misc Feature(19)7713..7883
Misc Feature(20)order(7743..7745,7803..7805)
Exon (1)1..367
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (2)368..444
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (3)445..828
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (4)829..1003
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (5)1004..1131
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (6)1132..1425
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (7)1426..1803
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (8)1804..1978
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (9)1979..2106
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (10)2107..2400
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (11)2401..2640
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (12)2641..7206
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (13)7207..7320
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (14)7321..7479
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (15)7480..7562
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (16)7563..7707
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (17)7708..7890
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (18)7891..8840
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Translation MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEV QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF APEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF HYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT GLPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTA VPSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAATEESTEGPSATEV PSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEE PYTPSPPVPSWTELPSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLD SSGLTSTVGSGLPVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSG EVLETSASGVGDLSGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVL ETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETT APGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPG VEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVED ISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISG LPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPS GEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEV LETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSGEVLET TAPGVEEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSGEVVETSA SGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDLSGLPSGGEGLETSAS EVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLGSGQAP ETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTASELEG RGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDVSGEIPGLFGVSGQPS GFPDTSGETSGVTELSGLSSGQPGISGEASGVLYGTSQPFGITDLSGETSGVPDLSGQPS GLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVELSGLPS GEADLSGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAEIGSSLPSG AYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMSGEHSG FLDLSGLQSGLIEPSGEPPGTPYFSGDFASTTNVSGESSVAMGTSGEASGLPEVTLITSE FVEGVTEPTISQELGQRPPVTHTPQLFESSGKVSTAGDISGATPVLPGSGVEVSSVPESS SETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEANLERSSGLGVSGSTLTFQEGE ASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVISTSIPES EWTQQTQRPAETHLEIESSSLLYSGEETHTVETATSPTDASIPASPEWKRESESTAAAPA RSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHFPDRET WVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFEN WRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEHARTFG QKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPQITCTDPTTYKRRLQKRSSRH PRRSRPSTAH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
194..195+dbSNP:
194..195+, cdbSNP:35909381
222+a, gdbSNP:183056139
314+c, tdbSNP:186720187
385+c, tdbSNP:202166561
387+c, tdbSNP:371249232
457+dbSNP:
457+c, gdbSNP:148320028
458+a, gdbSNP:371259802
488+a, gdbSNP:367956651
494+g, tdbSNP:374081272
509+c, tdbSNP:372517447
515+c, tdbSNP:368322348
536+c, tdbSNP:377037099
538+a, gdbSNP:370110892
559+a, cdbSNP:200239326
560+c, tdbSNP:191648646
573+a, gdbSNP:182894280
578+a, cdbSNP:372041880
604+a, gdbSNP:199701329
616+a, gdbSNP:373267308
652+a, gdbSNP:376202313
654+a, gdbSNP:370626315
674+c, tdbSNP:374544549
680+a, cdbSNP:16942318
703+c, tdbSNP:370458786
704+a, gdbSNP:373654303
744+c, tdbSNP:201105250
774+a, gdbSNP:372054790
791+c, tdbSNP:375073497
801+a, gdbSNP:372286756
806+a, cdbSNP:376762991
812+a, gdbSNP:35600223
818+c, tdbSNP:371875791
830+dbSNP:
830+c, tdbSNP:193277896
834+a, gdbSNP:370113313
866+c, tdbSNP:375322679
883+a, gdbSNP:367881858
886+c, tdbSNP:371065660
891+c, tdbSNP:374211268
893+g, tdbSNP:368963320
916+a, tdbSNP:199602867
926+a, gdbSNP:142615277
942+a, gdbSNP:374984332
944+c, tdbSNP:369187075
950+c, tdbSNP:373716409
956+c, tdbSNP:375544241
977+c, tdbSNP:146033080
1021+dbSNP:
1021+c, tdbSNP:191442526
1023+c, tdbSNP:370993153
1041+a, gdbSNP:374644024
1088+c, gdbSNP:368549781
1091+c, tdbSNP:371404599
1092+a, gdbSNP:200578079
1118+c, tdbSNP:35790816
1137+dbSNP:
1137+a, gdbSNP:377286945
1194+c, tdbSNP:369870175
1195+a, gdbSNP:373432805
1198+a, gdbSNP:34949187
1206..1207+, cdbSNP:35281241
1210+a, gdbSNP:184913582
1271+c, tdbSNP:371531556
1283+c, tdbSNP:368988256
1287+c, tdbSNP:372895171
1298+c, gdbSNP:117583968
1347+a, gdbSNP:200118502
1378+c, tdbSNP:370865297
1387+c, gdbSNP:374218750
1401+c, tdbSNP:376508432
1403+a, cdbSNP:12593024
1420+a, gdbSNP:79832113
1466+dbSNP:
1466+c, gdbSNP:372104051
1487+c, gdbSNP:370104735
1488+a, gdbSNP:372762081
1501+c, gdbSNP:377176198
1545+g, tdbSNP:369041225
1555+a, gdbSNP:200709031
1557+a, gdbSNP:117772298
1561+a, gdbSNP:371018764
1575+a, gdbSNP:200027891
1582+a, cdbSNP:368795077
1584+a, gdbSNP:148070768
1595+c, tdbSNP:16942341
1600+c, tdbSNP:200227191
1610+a, gdbSNP:116981974
1616+c, tdbSNP:375758859
1620+a, gdbSNP:370296999
1630+c, tdbSNP:374286796
1631+a, gdbSNP:368193007
1662+a, gdbSNP:367659235
1673+c, gdbSNP:372157525
1694+c, gdbSNP:368305201
1725+a, gdbSNP:372274447
1740+c, tdbSNP:181736584
1757+c, tdbSNP:371505346
1758+g, tdbSNP:200734577
1772+c, tdbSNP:185960535
1809+dbSNP:
1809+a, gdbSNP:369608360
1822+a, gdbSNP:200950723
1837+a, gdbSNP:202205582
1843+c, tdbSNP:117116488
1844+a, gdbSNP:373757072
1850+c, gdbSNP:139042772
1864+a, tdbSNP:117881662
1878+c, tdbSNP:149841431
1879+c, gdbSNP:144835580
1881+a, tdbSNP:374406298
1889+a, gdbSNP:34957282
1901+a, gdbSNP:371049725
1904+a, gdbSNP:34637731
1926+a, gdbSNP:267604363
1941+c, gdbSNP:372777485
1949+c, tdbSNP:367724066
1997+dbSNP:
1997+a, cdbSNP:2272023
1998+c, tdbSNP:143697605
1999+a, gdbSNP:151237327
2010+g, tdbSNP:62640041
2012+c, gdbSNP:369454178
2049+g, tdbSNP:373952066
2056+a, gdbSNP:376881991
2093+a, gdbSNP:57669733
2120+dbSNP:
2120+c, tdbSNP:374406755
2122+a, cdbSNP:377338540
2127+a, c, tdbSNP:144501729
2128+a, gdbSNP:375567241
2129+c, gdbSNP:368579188
2183+c, tdbSNP:1568116
2211+a, gdbSNP:377219636
2213+c, tdbSNP:188044698
2224+a, gdbSNP:34616796
2240+c, tdbSNP:35652696
2246+c, tdbSNP:371543651
2247+g, tdbSNP:148018909
2256+a, gdbSNP:200412974
2259+a, gdbSNP:369864209
2272+a, gdbSNP:35965913
2318+a, gdbSNP:201642680
2321+c, tdbSNP:377391149
2322+a, gdbSNP:201414869
2329+c, tdbSNP:373373120
2342+c, tdbSNP:74029641
2345+c, tdbSNP:376926374
2347+a, gdbSNP:370283261
2349+c, gdbSNP:181923062
2350+a, gdbSNP:374239823
2353+c, tdbSNP:141628105
2377+a, gdbSNP:77572130
2398+a, gdbSNP:35102652
2410+dbSNP:
2410+c, tdbSNP:367992413
2411+a, gdbSNP:372553119
2412+g, tdbSNP:377059310
2478+a, gdbSNP:370096577
2495+c, tdbSNP:377172993
2496+a, gdbSNP:35120858
2538+c, tdbSNP:267604364
2570+a, cdbSNP:372515989
2571+a, cdbSNP:377098407
2577+a, gdbSNP:202060628
2612+c, tdbSNP:150362784
2621+a, gdbSNP:137972043
2626+c, tdbSNP:373766961
2631+a, cdbSNP:376234405
2633+a, gdbSNP:370627724
2663+dbSNP:
2663+a, gdbSNP:2351491
2663+c, tdbSNP:386565448
2670+a, gdbSNP:150988100
2681+a, gdbSNP:191404107
2764+a, gdbSNP:78770909
2824+c, tdbSNP:200626682
2857+a, gdbSNP:201767607
complement(2888)-t, cdbSNP:3743399
2897+a, gdbSNP:74664106
2913+c, gdbSNP:372267862
2914+c, tdbSNP:267604365
2915+c, tdbSNP:201758384
2916+a, gdbSNP:368584197
2922+a, gdbSNP:150116620
complement(2965)-g, adbSNP:3743398
2977+a, gdbSNP:372878138
3006+a, gdbSNP:368547827
3022+a, gdbSNP:200269121
3027+c, gdbSNP:374881297
3083+a, tdbSNP:113581263
3111+a, cdbSNP:35430524
3119+a, gdbSNP:373065056
3132+c, tdbSNP:377554089
3134+a, gdbSNP:371065054
3163+g, tdbSNP:938608
3172+c, tdbSNP:376179210
3189+a, tdbSNP:938609
3216+c, gdbSNP:138620973
3233+g, tdbSNP:371044633
3296+c, tdbSNP:62023517
3310+g, tdbSNP:190556234
3321+c, gdbSNP:145274175
3326+c, tdbSNP:62023518
3327+a, gdbSNP:200194458
3339+a, gdbSNP:368974937
3383+c, tdbSNP:4080952
3384+a, gdbSNP:34570487
3440+c, tdbSNP:28496654
3440+c, tdbSNP:199752761
3441+a, gdbSNP:75032377
3441+ca, tgdbSNP:34309532
3497+c, tdbSNP:11633157
3554+c, tdbSNP:113229763
3558+a, gdbSNP:56244342
3611..3612+c, tdbSNP:75469674
3611+c, tdbSNP:77709198
3612+a, gdbSNP:373544100
3631..3632+dbSNP:71149237
3668+c, tdbSNP:62023519
complement(3709)-t, cdbSNP:112126237
3782+c, tdbSNP:71408894
3839+c, tdbSNP:71408895
3896+c, tdbSNP:67900127
3954+ca, tgdbSNP:375747798
4010+c, tdbSNP:79161342
4011+a, gdbSNP:11638262
4030+c, tdbSNP:61736998
4035+a, gdbSNP:112624191
4068+a, gdbSNP:113457214
4068+a, gdbSNP:199903498
4088+c, gdbSNP:200536240
complement(4108)-g, adbSNP:56162368
4125+a, gdbSNP:201500718
4132..4133+, cdbSNP:387906534
4182+a, gdbSNP:200089865
4200..4202+, gacdbSNP:200039781
4239+a, gdbSNP:201371548
4296+a, gdbSNP:201970173
4353+a, gdbSNP:200026339
4373+c, gdbSNP:201114885
4410+a, gdbSNP:202231802
4467+a, gdbSNP:200156631
4494+a, gdbSNP:201302102
4524+a, gdbSNP:61465251
4544+c, gdbSNP:201822759
4548+a, gdbSNP:56014140
4581+a, gdbSNP:12899191
4601+c, gdbSNP:28559926
4608+a, gdbSNP:372314637
4629+c, tdbSNP:11634626
4632+c, gdbSNP:376637662
4638+a, gdbSNP:35546357
4650+a, gdbSNP:371237177
4655+g, tdbSNP:377697360
4664+c, tdbSNP:78806382
4694+c, tdbSNP:369184696
4695+a, gdbSNP:200437529
4713+a, gdbSNP:112335908
4715+c, gdbSNP:201505307
4721+c, tdbSNP:60790354
4756+c, tdbSNP:375536994
4762+c, tdbSNP:369619909
4763+a, gdbSNP:373448175
4773+a, cdbSNP:368875483
4781+a, gdbSNP:373123198
4785+a, cdbSNP:376237216
4795..4797+, gagdbSNP:200944977
4803+c, gdbSNP:140867631
4809+a, gdbSNP:377592925
4817+c, gdbSNP:370647891
4833+a, cdbSNP:200795001
4841+a, gdbSNP:201463640
4845+c, tdbSNP:374560662
complement(4897)-t, gdbSNP:2882676
4897+a, cdbSNP:386576234
4899+c, tdbSNP:200479865
5013+a, gdbSNP:368770768
5041+a, tdbSNP:193215219
5083+c, tdbSNP:373706146
5124+a, gdbSNP:371634636
5129+c, tdbSNP:78523879
5142+c, tdbSNP:185250189
5168+g, tdbSNP:369641436
5201+a, gdbSNP:372339423
5223+a, gdbSNP:375929386
5238+a, gdbSNP:28407189
5242+a, gdbSNP:373469771
5271+c, tdbSNP:375957533
5333+a, gdbSNP:374570636
5349+c, gdbSNP:368698066
5452+a, cdbSNP:372919059
5459+g, tdbSNP:377132613
5467+a, gdbSNP:375118386
5486+a, gdbSNP:267604366
5521+g, tdbSNP:79925540
5539+c, gdbSNP:200794149
5622+c, tdbSNP:367732005
5626+a, gdbSNP:371211794
5627+a, gdbSNP:374041400
5638+a, tdbSNP:367925946
5643+a, gdbSNP:202054679
5667+a, gdbSNP:4932439
5692+c, tdbSNP:147886342
5727+c, gdbSNP:139182220
5742+a, tdbSNP:201149160
5751+c, gdbSNP:377189756
5775+a, gdbSNP:71403956
5792+g, tdbSNP:368893175
5817+c, tdbSNP:373012933
5844+a, gdbSNP:375361510
5847+a, gdbSNP:369426643
5858+g, tdbSNP:373280545
5866+a, tdbSNP:376225697
5868+g, tdbSNP:370620670
5892+g, tdbSNP:373484583
5920+g, tdbSNP:34124958
5937+c, tdbSNP:74505897
5941+a, gdbSNP:200762388
5954+c, tdbSNP:370763565
5955+a, gdbSNP:201212378
5958+a, gdbSNP:267604367
5981+c, tdbSNP:149963286
5990+a, gdbSNP:372303872
6037+c, tdbSNP:377284915
6049+c, tdbSNP:368491136
6070+a, gdbSNP:190099162
6074+c, tdbSNP:375848120
6130+c, tdbSNP:200271564
6153+a, gdbSNP:373374575
complement(6173)-c, adbSNP:3825994
6174+c, gdbSNP:76282091
6234+g, tdbSNP:181541436
6294+a, gdbSNP:369221267
6295+c, tdbSNP:74477529
6305+g, tdbSNP:200212015
6341+c, tdbSNP:201107277
6343+c, gdbSNP:372709777
6360+a, gdbSNP:377010256
6366..6367+, ccdbSNP:201923184
6372+a, gdbSNP:34546634
6373+a, gdbSNP:367930275
6383+c, tdbSNP:35676128
6387+a, gdbSNP:199709827
6400+c, tdbSNP:207475683
6404+c, tdbSNP:368840579
6412+a, gdbSNP:372805764
6427+a, cdbSNP:375734624
6431+c, tdbSNP:371314805
6439+c, tdbSNP:375008777
6460+c, tdbSNP:369174647
6487+c, tdbSNP:149083251
6498+a, gdbSNP:200423695
6501+a, gdbSNP:267604368
6516+c, gdbSNP:201538650
6517+a, cdbSNP:34074148
6519+a, cdbSNP:369443823
6520+c, tdbSNP:200203683
6521+c, tdbSNP:373971849
6533+a, gdbSNP:376899394
6547+c, tdbSNP:35061438
6547+c, tdbSNP:386449492
6550+c, tdbSNP:373173874
6606+g, tdbSNP:185800102
6609+a, gdbSNP:1042630
6637+c, gdbSNP:201755419
6680+a, gdbSNP:62023520
6682+c, tdbSNP:375589819
6686+c, tdbSNP:368590289
6694+c, tdbSNP:371419855
6734+c, gdbSNP:34153007
6785+c, tdbSNP:34543273
6786+a, gdbSNP:371628768
6794+c, tdbSNP:372625220
6797+c, tdbSNP:1042631
6824+c, tdbSNP:371937649
6825+a, gdbSNP:143156437
6851+c, gdbSNP:369871844
6852+a, gdbSNP:373460432
6860+c, tdbSNP:377405150
6865+c, tdbSNP:368693410
6880+a, gdbSNP:116530539
6904+c, tdbSNP:188663484
6910+c, tdbSNP:376406609
6923+c, gdbSNP:371290730
6945+g, tdbSNP:377558109
6999+c, tdbSNP:374434189
7023+a, tdbSNP:367726004
7029+c, gdbSNP:371239048
7057+a, gdbSNP:374891622
7062+g, tdbSNP:201436752
7069+c, tdbSNP:181029183
7088+c, tdbSNP:369329108
7090+c, tdbSNP:372580346
7097+c, tdbSNP:140306805
7098+c, gdbSNP:373438469
7101+c, tdbSNP:368163315
7138+c, gdbSNP:372788256
7144+c, gdbSNP:145203473
complement(7154)-c, adbSNP:698621
7157+c, tdbSNP:368877815
7172+a, gdbSNP:376248183
7185+a, gdbSNP:369258827
7211+dbSNP:
7211+c, tdbSNP:376745222
7255+a, cdbSNP:370618858
7268+a, cdbSNP:373512626
7271+c, tdbSNP:370259683
7272+a, gdbSNP:373674144
7274+c, tdbSNP:368166847
7310+c, gdbSNP:370515602
7317+a, gdbSNP:374577791
7352+dbSNP:
7352+a, gdbSNP:368979713
7382+a, gdbSNP:372888180
7388+c, tdbSNP:182888026
7392+a, tdbSNP:369624139
7411+a, gdbSNP:199999713
7419+c, tdbSNP:376535037
7420+a, gdbSNP:200921049
7442+c, tdbSNP:368404569
7448+c, tdbSNP:376206831
7449+a, gdbSNP:150555123
7457+c, tdbSNP:35446117
7484+dbSNP:
7484+c, tdbSNP:375863291
complement(7493)-g, cdbSNP:3817428
7514+c, tdbSNP:372066173
7515+a, gdbSNP:121913568
7531+c, gdbSNP:374842225
7540+a, gdbSNP:368833137
7607+dbSNP:
7607+c, tdbSNP:141037246
7608+a, gdbSNP:192568553
7623+a, gdbSNP:267606625
7640+c, tdbSNP:373470699
7641+a, gdbSNP:183636867
7650+a, gdbSNP:201154137
7715+dbSNP:
7715+c, tdbSNP:117879889
7716+a, gdbSNP:202059945
7722+c, tdbSNP:375041472
7752+a, gdbSNP:200180285
7784+c, tdbSNP:190361551
7791+c, tdbSNP:149099819
7822+a, gdbSNP:368796568
7840+a, gdbSNP:200868527
7858+a, gdbSNP:201983356
7872+c, gdbSNP:367553476
7873+a, gdbSNP:1126823
7890+c, tdbSNP:201449366
7930+dbSNP:
7930+a, gdbSNP:377398069
7947+c, tdbSNP:368681276
7948+a, gdbSNP:186576211
7984+a, gdbSNP:377128538
7994+c, tdbSNP:370912629
8003+c, tdbSNP:374133594
8022+c, tdbSNP:114820113
complement(8157)-c, adbSNP:150780510
8166+a, gdbSNP:189855701
8168+c, tdbSNP:181173463
8240+a, gdbSNP:368319248
8269+, gdbSNP:141417438
8345+c, tdbSNP:76635155
complement(8355)-t, gdbSNP:137976779
8383..8384+, ggadbSNP:377520763
8443+c, tdbSNP:371957402
8463+a, tdbSNP:375287129
8486+a, cdbSNP:73458267
8512+c, gdbSNP:368712709
8581+c, tdbSNP:74892133
8624+c, tdbSNP:371300162
8640+c, tdbSNP:73458269
8711+c, tdbSNP:143545838
Gene SymbolACAN
Gene SynonymAGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Chromosome15
Locus Map15q26.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_013227 Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA. On-demand TBD TBD
NM_013227 Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA. On-demand TBD TBD
NM_013227 Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA. On-demand TBD TBD
Title Antigen-specific B lymphocytes acquire proteoglycan aggrecan from cartilage extracellular matrix resulting in antigen presentation and CD4+ T-cell activation .
Author Ciechomska M, Wilson CL, Floudas A, Hui W, Rowan AD, van Eden W, Robinson JH and Knight AM.
Journal Immunology 141 (1), 70-78 (2014)
Title ADAMTS-4_v1 is a splice variant of ADAMTS-4 that is expressed as a protein in human synovium and cleaves aggrecan at the interglobular domain .
Author Wainwright SD, Bondeson J, Caterson B and Hughes CE.
Journal Arthritis Rheum. 65 (11), 2866-2875 (2013)
Title ISSLS Prize winner: Effect of link protein peptide on human intervertebral disc cells .
Author Wang Z, Hutton WC and Yoon ST.
Journal Spine 38 (17), 1501-1507 (2013)
Title Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture .
Author Berndt SI, Gustafsson S, Magi R, Ganna A, Wheeler E, Feitosa MF, Justice AE, Monda KL, Croteau-Chonka DC, Day FR, Esko T, Fall T, Ferreira T, Gentilini D, Jackson AU, Luan J, Randall JC, Vedantam S, Willer CJ, Winkler TW, Wood AR, Workalemahu T, Hu YJ, Lee SH, Liang L, Lin DY, Min JL, Neale BM, Thorleifsson G, Yang J, Albrecht E, Amin N, Bragg-Gresham JL, Cadby G, den Heijer M, Eklund N, Fischer K, Goel A, Hottenga JJ, Huffman JE, Jarick I, Johansson A, Johnson T, Kanoni S, Kleber ME, Konig IR, Kristiansson K, Kutalik Z, Lamina C, Lecoeur C, Li G, Mangino M, McArdle WL, Medina-Gomez C, Muller-Nurasyid M, Ngwa JS, Nolte IM, Paternoster L, Pechlivanis S, Perola M, Peters MJ, Preuss M, Rose LM, Shi J, Shungin D, Smith AV, Strawbridge RJ, Surakka I, Teumer A, Trip MD, Tyrer J, Van Vliet-Ostaptchouk JV, Vandenput L, Waite LL, Zhao JH, Absher D, Asselbergs FW, Atalay M, Attwood AP, Balmforth AJ, Basart H, Beilby J, Bonnycastle LL, Brambilla P, Bruinenberg M, Campbell H, Chasman DI, Chines PS, Collins FS, Connell JM, Cookson WO, de Faire U, de Vegt F, Dei M, Dimitriou M, Edkins S, Estrada K, Evans DM, Farrall M, Ferrario MM, Ferrieres J, Franke L, Frau F, Gejman PV, Grallert H, Gronberg H, Gudnason V, Hall AS, Hall P, Hartikainen AL, Hayward C, Heard-Costa NL, Heath AC, Hebebrand J, Homuth G, Hu FB, Hunt SE, Hypponen E, Iribarren C, Jacobs KB, Jansson JO, Jula A, Kahonen M, Kathiresan S, Kee F, Khaw KT, Kivimaki M, Koenig W, Kraja AT, Kumari M, Kuulasmaa K, Kuusisto J, Laitinen JH, Lakka TA, Langenberg C, Launer LJ, Lind L, Lindstrom J, Liu J, Liuzzi A, Lokki ML, Lorentzon M, Madden PA, Magnusson PK, Manunta P, Marek D, Marz W, Mateo Leach I, McKnight B, Medland SE, Mihailov E, Milani L, Montgomery GW, Mooser V, Muhleisen TW, Munroe PB, Musk AW, Narisu N, Navis G, Nicholson G, Nohr EA, Ong KK, Oostra BA, Palmer CN, Palotie A, Peden JF, Pedersen N, Peters A, Polasek O, Pouta A, Pramstaller PP, Prokopenko I, Putter C, Radhakrishnan A, Raitakari O, Rendon A, Rivadeneira F, Rudan I, Saaristo TE, Sambrook JG, Sanders AR, Sanna S, Saramies J, Schipf S, Schreiber S, Schunkert H, Shin SY, Signorini S, Sinisalo J, Skrobek B, Soranzo N, Stancakova A, Stark K, Stephens JC, Stirrups K, Stolk RP, Stumvoll M, Swift AJ, Theodoraki EV, Thorand B, Tregouet DA, Tremoli E, Van der Klauw MM, van Meurs JB, Vermeulen SH, Viikari J, Virtamo J, Vitart V, Waeber G, Wang Z, Widen E, Wild SH, Willemsen G, Winkelmann BR, Witteman JC, Wolffenbuttel BH, Wong A, Wright AF, Zillikens MC, Amouyel P, Boehm BO, Boerwinkle E, Boomsma DI, Caulfield MJ, Chanock SJ, Cupples LA, Cusi D, Dedoussis GV, Erdmann J, Eriksson JG, Franks PW, Froguel P, Gieger C, Gyllensten U, Hamsten A, Harris TB, Hengstenberg C, Hicks AA, Hingorani A, Hinney A, Hofman A, Hovingh KG, Hveem K, Illig T, Jarvelin MR, Jockel KH, Keinanen-Kiukaanniemi SM, Kiemeney LA, Kuh D, Laakso M, Lehtimaki T, Levinson DF, Martin NG, Metspalu A, Morris AD, Nieminen MS, Njolstad I, Ohlsson C, Oldehinkel AJ, Ouwehand WH, Palmer LJ, Penninx B, Power C, Province MA, Psaty BM, Qi L, Rauramaa R, Ridker PM, Ripatti S, Salomaa V, Samani NJ, Snieder H, Sorensen TI, Spector TD, Stefansson K, Tonjes A, Tuomilehto J, Uitterlinden AG, Uusitupa M, van der Harst P, Vollenweider P, Wallaschofski H, Wareham NJ, Watkins H, Wichmann HE, Wilson JF, Abecasis GR, Assimes TL, Barroso I, Boehnke M, Borecki IB, Deloukas P, Fox CS, Frayling T, Groop LC, Haritunian T, Heid IM, Hunter D, Kaplan RC, Karpe F, Moffatt MF, Mohlke KL, O'Connell JR, Pawitan Y, Schadt EE, Schlessinger D, Steinthorsdottir V, Strachan DP, Thorsteinsdottir U, van Duijn CM, Visscher PM, Di Blasio AM, Hirschhorn JN, Lindgren CM, Morris AP, Meyre D, Scherag A, McCarthy MI, Speliotes EK, North KE, Loos RJ and Ingelsson E.
Journal Nat. Genet. 45 (5), 501-512 (2013)
Title Incomplete elongation of the chondroitin sulfate linkage region on aggrecan and response to interleukin-1beta .
Author Frankenberger C, Borgia JA, Edirisinghe PD and Oegema TR.
Journal Connect. Tissue Res. 54 (2), 123-131 (2013)
Title The interglobular domain of cartilage aggrecan is cleaved by PUMP, gelatinases, and cathepsin B .
Author Fosang AJ, Neame PJ, Last K, Hardingham TE, Murphy G and Hamilton JA.
Journal J. Biol. Chem. 267 (27), 19470-19474 (1992)
Title The structure of aggrecan fragments in human synovial fluid. Evidence for the involvement in osteoarthritis of a novel proteinase which cleaves the Glu 373-Ala 374 bond of the interglobular domain .
Author Sandy JD, Flannery CR, Neame PJ and Lohmander LS.
Journal J. Clin. Invest. 89 (5), 1512-1516 (1992)
Title Complete coding sequence and deduced primary structure of the human cartilage large aggregating proteoglycan, aggrecan. Human-specific repeats, and additional alternatively spliced forms .
Author Doege KJ, Sasaki M, Kimura T and Yamada Y.
Journal J. Biol. Chem. 266 (2), 894-902 (1991)
Title A new epidermal growth factor-like domain in the human core protein for the large cartilage-specific proteoglycan. Evidence for alternative splicing of the domain .
Author Baldwin CT, Reginato AM and Prockop DJ.
Journal J. Biol. Chem. 264 (27), 15747-15750 (1989)
Title Absence of proteoglycan core protein in cartilage from the cmd/cmd (cartilage matrix deficiency) mouse .
Author Kimata,K., Barrach,H.J., Brown,K.S. and Pennypacker,J.P.
Journal J. Biol. Chem. 256 (13), 6961-6968 (1981)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.