• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_013227 Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA. ORF Sequence $3416.85
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_013227.3, 256017256
Length 8840 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA.
Product aggrecan core protein isoform 2 precursor
Comment

Summary: This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) represents the longer transcript and it encodes the longer protein (isoform 2). Isoform 2 contains an EGF-like and a CRP-like domain in the C-terminus.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_037359.3
CDS 375..7967
Misc Feature(1)369..371
Misc Feature(2)369..371
Misc Feature(3)462..818
Misc Feature(4)501..836
Misc Feature(5)831..1115
Misc Feature(6)861..866
Misc Feature(7)1134..1421
Misc Feature(8)1155..1160
Misc Feature(9)1806..2090
Misc Feature(10)1836..1841
Misc Feature(11)2109..2396
Misc Feature(12)2130..2135
Misc Feature(13)7221..7313
Misc Feature(14)7332..7703
Misc Feature(15)order(7386..7388,7482..7493,7578..7580,7608..7610,
Misc Feature(16)order(7515..7517,7527..7529,7596..7598,7614..7619)
Misc Feature(17)order(7527..7529,7617..7619)
Misc Feature(18)order(7587..7589,7593..7595,7614..7616,7656..7661)
Misc Feature(19)7713..7883
Misc Feature(20)order(7743..7745,7803..7805)
Exon (1)1..367
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (2)368..444
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (3)445..828
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (4)829..1003
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (5)1004..1131
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (6)1132..1425
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (7)1426..1803
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (8)1804..1978
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (9)1979..2106
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (10)2107..2400
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (11)2401..2640
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (12)2641..7206
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (13)7207..7320
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (14)7321..7479
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (15)7480..7562
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (16)7563..7707
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (17)7708..7890
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Exon (18)7891..8840
Gene:ACAN
Gene Synonym:AGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Translation MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEV QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF APEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF HYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT GLPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTA VPSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAATEESTEGPSATEV PSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEE PYTPSPPVPSWTELPSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLD SSGLTSTVGSGLPVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSG EVLETSASGVGDLSGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVL ETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETT APGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPG VEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVED ISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISG LPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPS GEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEV LETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSGEVLET TAPGVEEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSGEVVETSA SGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDLSGLPSGGEGLETSAS EVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLGSGQAP ETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTASELEG RGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDVSGEIPGLFGVSGQPS GFPDTSGETSGVTELSGLSSGQPGISGEASGVLYGTSQPFGITDLSGETSGVPDLSGQPS GLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVELSGLPS GEADLSGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAEIGSSLPSG AYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMSGEHSG FLDLSGLQSGLIEPSGEPPGTPYFSGDFASTTNVSGESSVAMGTSGEASGLPEVTLITSE FVEGVTEPTISQELGQRPPVTHTPQLFESSGKVSTAGDISGATPVLPGSGVEVSSVPESS SETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEANLERSSGLGVSGSTLTFQEGE ASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVISTSIPES EWTQQTQRPAETHLEIESSSLLYSGEETHTVETATSPTDASIPASPEWKRESESTAAAPA RSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHFPDRET WVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFEN WRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEHARTFG QKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPQITCTDPTTYKRRLQKRSSRH PRRSRPSTAH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
194..195+dbSNP:
194..195+, cdbSNP:35909381
222+a, gdbSNP:183056139
314+c, tdbSNP:186720187
385+c, tdbSNP:202166561
457+dbSNP:
457+c, gdbSNP:148320028
559+a, cdbSNP:200239326
560+c, tdbSNP:191648646
573+a, gdbSNP:182894280
604+a, gdbSNP:199701329
680+a, cdbSNP:16942318
744+c, tdbSNP:201105250
812+a, gdbSNP:35600223
830+dbSNP:
830+c, tdbSNP:193277896
916+a, tdbSNP:199602867
926+a, gdbSNP:142615277
977+c, tdbSNP:146033080
1021+dbSNP:
1021+c, tdbSNP:191442526
1092+a, gdbSNP:200578079
1118+c, tdbSNP:35790816
1198+dbSNP:
1198+a, gdbSNP:34949187
1206..1207+, cdbSNP:35281241
1210+a, gdbSNP:184913582
1298+c, gdbSNP:117583968
1347+a, gdbSNP:200118502
1403+a, cdbSNP:12593024
1420+a, gdbSNP:79832113
1555+dbSNP:
1555+a, gdbSNP:200709031
1557+a, gdbSNP:117772298
1575+a, gdbSNP:200027891
1584+a, gdbSNP:148070768
1595+c, tdbSNP:16942341
1600+c, tdbSNP:200227191
1610+a, gdbSNP:116981974
1740+c, tdbSNP:181736584
1758+g, tdbSNP:200734577
1772+c, tdbSNP:185960535
1822+dbSNP:
1822+a, gdbSNP:200950723
1837+a, gdbSNP:202205582
1843+c, tdbSNP:117116488
1850+c, gdbSNP:139042772
1864+a, tdbSNP:117881662
1878+c, tdbSNP:149841431
1879+c, gdbSNP:144835580
1889+a, gdbSNP:34957282
1904+a, gdbSNP:34637731
1997+dbSNP:
1997+a, cdbSNP:2272023
1998+c, tdbSNP:143697605
1999+a, gdbSNP:151237327
2010+g, tdbSNP:62640041
2093+a, gdbSNP:57669733
2127+dbSNP:
2127+a, cdbSNP:144501729
2183+c, tdbSNP:1568116
2213+c, tdbSNP:188044698
2224+a, gdbSNP:34616796
2240+c, tdbSNP:35652696
2247+g, tdbSNP:148018909
2256+a, gdbSNP:200412974
2272+a, gdbSNP:35965913
2318+a, gdbSNP:201642680
2322+a, gdbSNP:201414869
2342+c, tdbSNP:74029641
2349+c, gdbSNP:181923062
2353+c, tdbSNP:141628105
2377+a, gdbSNP:77572130
2398+a, gdbSNP:35102652
2496+dbSNP:
2496+a, gdbSNP:35120858
2577+a, gdbSNP:202060628
2612+c, tdbSNP:150362784
2621+a, gdbSNP:137972043
2663+dbSNP:
2663+a, gdbSNP:2351491
2670+a, gdbSNP:150988100
2681+a, gdbSNP:191404107
2764+a, gdbSNP:78770909
2824+c, tdbSNP:200626682
2857+a, gdbSNP:201767607
2888+c, tdbSNP:3743399
2897+a, gdbSNP:74664106
2915+c, tdbSNP:201758384
2922+a, gdbSNP:150116620
2965+a, gdbSNP:3743398
3022+a, gdbSNP:200269121
3083+a, tdbSNP:113581263
3111+a, cdbSNP:35430524
3163+g, tdbSNP:938608
3189+a, tdbSNP:938609
3216+c, gdbSNP:138620973
3296+c, tdbSNP:62023517
3310+g, tdbSNP:190556234
3321+c, gdbSNP:145274175
3326+c, tdbSNP:62023518
3327+a, gdbSNP:200194458
3383+c, tdbSNP:4080952
3383+c, tdbSNP:199752761
3384+a, gdbSNP:34570487
3387+a, gdbSNP:56244342
3440+c, tdbSNP:28496654
3441+a, gdbSNP:76764947
3497+c, tdbSNP:11633157
3554+c, tdbSNP:113229763
3611+c, tdbSNP:77709198
3612+a, gdbSNP:75032377
3668+c, tdbSNP:62023519
3709+c, tdbSNP:112126237
3725+c, tdbSNP:75469674
3840+a, gdbSNP:113457214
3954+ca, tgdbSNP:34309532
4010+c, tdbSNP:79161342
4011+a, gdbSNP:11638262
4035+a, gdbSNP:112624191
4068+a, gdbSNP:199903498
4087+c, tdbSNP:61736998
4088+c, gdbSNP:200536240
4092+a, gdbSNP:56014140
4108+a, gdbSNP:56162368
4124+c, tdbSNP:71408893
4125+a, gdbSNP:201500718
4181+c, tdbSNP:71408894
4182+a, gdbSNP:200089865
4200..4202+, gacdbSNP:200039781
4238+c, tdbSNP:71408895
4239+a, gdbSNP:201371548
4295+c, tdbSNP:67900127
4296+a, gdbSNP:201970173
4353+a, gdbSNP:200026339
4373+c, gdbSNP:201114885
4410+a, gdbSNP:202231802
4467+a, gdbSNP:200156631
4494+a, gdbSNP:201302102
4524+a, gdbSNP:61465251
4544+c, gdbSNP:201822759
4581+a, gdbSNP:12899191
4601+c, gdbSNP:28559926
4629+c, tdbSNP:11634626
4638+a, gdbSNP:35546357
4664+c, tdbSNP:78806382
4695+a, gdbSNP:200437529
4713+a, gdbSNP:112335908
4715+c, gdbSNP:201505307
4721+c, tdbSNP:60790354
4795..4797+, gagdbSNP:200944977
4803+c, gdbSNP:140867631
4833+a, cdbSNP:200795001
4841+a, gdbSNP:201463640
4897+g, tdbSNP:2882676
4899+c, tdbSNP:200479865
5041+a, tdbSNP:193215219
5129+c, tdbSNP:78523879
5142+c, tdbSNP:185250189
5238+a, gdbSNP:28407189
5521+g, tdbSNP:79925540
5539+c, gdbSNP:200794149
5643+a, gdbSNP:202054679
5667+a, gdbSNP:4932439
5692+c, tdbSNP:147886342
5727+c, gdbSNP:139182220
5742+a, tdbSNP:201149160
5775+a, gdbSNP:71403956
5920+g, tdbSNP:34124958
5937+c, tdbSNP:74505897
5941+a, gdbSNP:200762388
5955+a, gdbSNP:201212378
5981+c, tdbSNP:149963286
6070+a, gdbSNP:190099162
6130+c, tdbSNP:200271564
6173+a, cdbSNP:3825994
6174+c, gdbSNP:76282091
6234+g, tdbSNP:181541436
6295+c, tdbSNP:74477529
6305+g, tdbSNP:200212015
6341+c, tdbSNP:201107277
6366..6367+, ccdbSNP:201923184
6372+a, gdbSNP:34546634
6383+c, tdbSNP:35676128
6387+a, gdbSNP:199709827
6400+c, tdbSNP:207475683
6487+c, tdbSNP:149083251
6498+a, gdbSNP:200423695
6516+c, gdbSNP:201538650
6517+a, cdbSNP:34074148
6520+c, tdbSNP:200203683
6547+c, tdbSNP:35061438
6606+g, tdbSNP:185800102
6609+a, gdbSNP:1042630
6637+c, gdbSNP:201755419
6680+a, gdbSNP:62023520
6734+c, gdbSNP:34153007
6785+c, tdbSNP:34543273
6797+c, tdbSNP:1042631
6825+a, gdbSNP:143156437
6880+a, gdbSNP:116530539
6904+c, tdbSNP:188663484
7062+g, tdbSNP:201436752
7069+c, tdbSNP:181029183
7097+c, tdbSNP:140306805
7144+c, gdbSNP:145203473
7154+a, cdbSNP:698621
7388+dbSNP:
7388+c, tdbSNP:182888026
7411+a, gdbSNP:199999713
7420+a, gdbSNP:200921049
7449+a, gdbSNP:150555123
7457+c, tdbSNP:35446117
7493+dbSNP:
7493+c, gdbSNP:3817428
7515+a, gdbSNP:121913568
7607+dbSNP:
7607+c, tdbSNP:141037246
7608+a, gdbSNP:192568553
7623+a, gdbSNP:267606625
7641+a, gdbSNP:183636867
7650+a, gdbSNP:201154137
7715+dbSNP:
7715+c, tdbSNP:117879889
7716+a, gdbSNP:202059945
7752+a, gdbSNP:200180285
7784+c, tdbSNP:190361551
7791+c, tdbSNP:149099819
7840+a, gdbSNP:200868527
7858+a, gdbSNP:201983356
7873+a, gdbSNP:1126823
7890+c, tdbSNP:201449366
7948+dbSNP:
7948+a, gdbSNP:186576211
8022+c, tdbSNP:114820113
8157+a, cdbSNP:150780510
8166+a, gdbSNP:189855701
8168+c, tdbSNP:181173463
8269+, gdbSNP:141417438
8345+c, tdbSNP:76635155
8355+g, tdbSNP:137976779
8486+a, cdbSNP:73458267
8581+c, tdbSNP:74892133
8640+c, tdbSNP:73458269
8711+c, tdbSNP:143545838
Gene SymbolACAN
Gene SynonymAGC1; AGCAN; CSPG1; CSPGCP; MSK16; SEDK
Chromosome15
Locus Map15q26.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001135 Homo sapiens aggrecan (ACAN), transcript variant 1, mRNA. Full Length Quote
ORF Sequence $3283.20
NM_013227 Homo sapiens aggrecan (ACAN), transcript variant 2, mRNA. Full Length Quote
ORF Sequence $3416.85
Title MMP proteolysis of the human extracellular matrix protein aggrecan is mainly a process of normal turnover .
Author Struglics,A. and Hansson,M.
Journal Biochem. J. 446 (2), 213-223 (2012)
Title Aggrecan: Beyond cartilage and into the brain .
Author Morawski,M., Bruckner,G., Arendt,T. and Matthews,R.T.
Journal Int. J. Biochem. Cell Biol. 44 (5), 690-693 (2012)
Title Chondrogenic differentiation of induced pluripotent stem cells from osteoarthritic chondrocytes in alginate matrix .
Author Wei,Y., Zeng,W., Wan,R., Wang,J., Zhou,Q., Qiu,S. and Singh,S.R.
Journal Eur Cell Mater 23, 1-12 (2012)
Title [Effects of Chinese herbal medicine Yiqi Huayu Bushen Recipe on expressions of aggrecan and type X collagen mRNAs in cells from degenerated human intervertebral discs] .
Author Li,J.B., Zhao,H.Y., Zhao,Y.J., Zhou,Q., Li,N., Xu,P., Shi,Q. and Wang,Y.J.
Journal Zhong Xi Yi Jie He Xue Bao 9 (10), 1138-1144 (2011)
Title Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry .
Author N'Diaye,A., Chen,G.K., Palmer,C.D., Ge,B., Tayo,B., Mathias,R.A., Ding,J., Nalls,M.A., Adeyemo,A., Adoue,V., Ambrosone,C.B., Atwood,L., Bandera,E.V., Becker,L.C., Berndt,S.I., Bernstein,L., Blot,W.J., Boerwinkle,E., Britton,A., Casey,G., Chanock,S.J., Demerath,E., Deming,S.L., Diver,W.R., Fox,C., Harris,T.B., Hernandez,D.G., Hu,J.J., Ingles,S.A., John,E.M., Johnson,C., Keating,B., Kittles,R.A., Kolonel,L.N., Kritchevsky,S.B., Le Marchand,L., Lohman,K., Liu,J., Millikan,R.C., Murphy,A., Musani,S., Neslund-Dudas,C., North,K.E., Nyante,S., Ogunniyi,A., Ostrander,E.A., Papanicolaou,G., Patel,S., Pettaway,C.A., Press,M.F., Redline,S., Rodriguez-Gil,J.L., Rotimi,C., Rybicki,B.A., Salako,B., Schreiner,P.J., Signorello,L.B., Singleton,A.B., Stanford,J.L., Stram,A.H., Stram,D.O., Strom,S.S., Suktitipat,B., Thun,M.J., Witte,J.S., Yanek,L.R., Ziegler,R.G., Zheng,W., Zhu,X., Zmuda,J.M., Zonderman,A.B., Evans,M.K., Liu,Y., Becker,D.M., Cooper,R.S., Pastinen,T., Henderson,B.E., Hirschhorn,J.N., Lettre,G. and Haiman,C.A.
Journal PLoS Genet. 7 (10), E1002298 (2011)
Title The interglobular domain of cartilage aggrecan is cleaved by PUMP, gelatinases, and cathepsin B .
Author Fosang,A.J., Neame,P.J., Last,K., Hardingham,T.E., Murphy,G. and Hamilton,J.A.
Journal J. Biol. Chem. 267 (27), 19470-19474 (1992)
Title The structure of aggrecan fragments in human synovial fluid. Evidence for the involvement in osteoarthritis of a novel proteinase which cleaves the Glu 373-Ala 374 bond of the interglobular domain .
Author Sandy,J.D., Flannery,C.R., Neame,P.J. and Lohmander,L.S.
Journal J. Clin. Invest. 89 (5), 1512-1516 (1992)
Title Complete coding sequence and deduced primary structure of the human cartilage large aggregating proteoglycan, aggrecan. Human-specific repeats, and additional alternatively spliced forms .
Author Doege,K.J., Sasaki,M., Kimura,T. and Yamada,Y.
Journal J. Biol. Chem. 266 (2), 894-902 (1991)
Title A new epidermal growth factor-like domain in the human core protein for the large cartilage-specific proteoglycan. Evidence for alternative splicing of the domain .
Author Baldwin,C.T., Reginato,A.M. and Prockop,D.J.
Journal J. Biol. Chem. 264 (27), 15747-15750 (1989)
Title Absence of proteoglycan core protein in cartilage from the cmd/cmd (cartilage matrix deficiency) mouse .
Author Kimata,K., Barrach,H.J., Brown,K.S. and Pennypacker,J.P.
Journal J. Biol. Chem. 256 (13), 6961-6968 (1981)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878