• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens eukaryotic translation initiation factor 3, subunit K (EIF3K), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_013234 Homo sapiens eukaryotic translation initiation factor 3, subunit K (EIF3K), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_013234.2, 83656777
Length 910 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens eukaryotic translation initiation factor 3, subunit K (EIF3K), mRNA.
Product eukaryotic translation initiation factor 3 subunit K
Comment

Summary: The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM, Mar 2008].


##Evidence-Data-START## Transcript exon combination :: BC001031.2, AF077051.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length.

RefSeq NP_037366.1
CDS 188..844
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)109
Misc Feature(4)191..193
Misc Feature(5)191..193
Misc Feature(6)248..676
Misc Feature(7)365..787
Misc Feature(8)833..835
Misc Feature(9)836..838
Misc Feature(10)836..838
Exon (1)1..246
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Exon (2)247..345
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Exon (3)346..466
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Exon (4)467..541
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Exon (5)542..608
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Exon (6)609..686
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Exon (7)687..812
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Exon (8)813..879
Gene:EIF3K
Gene Synonym:ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Translation MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAF FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWS ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(61)-t, cdbSNP:149561809
63+a, gdbSNP:2232993
79+a, tdbSNP:144299925
89+c, tdbSNP:140799444
120+c, tdbSNP:112447585
138+g, tdbSNP:201812654
140+c, tdbSNP:2232994
141+g, tdbSNP:2232995
143+g, tdbSNP:372381183
160+g, tdbSNP:375807765
167+c, tdbSNP:369039219
182+a, gdbSNP:371960290
223+a, cdbSNP:2232996
272+dbSNP:
272+c, tdbSNP:188806390
306+a, gdbSNP:373893911
315+a, gdbSNP:201883520
316+c, tdbSNP:145317573
324+c, gdbSNP:376238584
327+a, gdbSNP:149062652
365+dbSNP:
365+c, tdbSNP:143069816
372+a, tdbSNP:371604503
379+a, gdbSNP:376704723
409+c, tdbSNP:369118132
complement(427)-t, gdbSNP:1141727
427+g, tdbSNP:386518167
454+c, tdbSNP:138683949
467+dbSNP:
467+a, cdbSNP:78190827
475+c, tdbSNP:1141726
485+c, tdbSNP:375893694
496+a, gdbSNP:369972003
582+dbSNP:
582+c, tdbSNP:370407696
590+a, gdbSNP:372914594
592+a, gdbSNP:369298575
599+a, gdbSNP:78751736
623+dbSNP:
623+a, gdbSNP:200052604
650+c, tdbSNP:371972989
655+a, gdbSNP:201324415
664+c, tdbSNP:147020583
684+c, tdbSNP:375272283
703+a, gdbSNP:141773032
706+c, gdbSNP:377082891
718+c, tdbSNP:150144747
723+a, gdbSNP:201343431
complement(725)-t, cdbSNP:77863139
726+a, gdbSNP:199953066
731+a, gdbSNP:138580388
736+a, gdbSNP:200004532
742+a, gdbSNP:373079379
759+c, gdbSNP:149596689
768..769+a, tdbSNP:11558208
769..770+a, gdbSNP:11558217
787+c, tdbSNP:201743234
796+a, gdbSNP:377673715
798+a, gdbSNP:112371818
801+c, tdbSNP:200335367
820+dbSNP:
820+c, tdbSNP:201760106
838+c, tdbSNP:200802866
841+c, gdbSNP:200576883
878+a, cdbSNP:113951699
879+a, cdbSNP:113024296
Gene SymbolEIF3K
Gene SynonymARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001
Chromosome19
Locus Map19q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_013234 Homo sapiens eukaryotic translation initiation factor 3, subunit K (EIF3K), mRNA. In-stock $308.00 $259.00 10
XM_006723147 PREDICTED: Homo sapiens eukaryotic translation initiation factor 3, subunit K (EIF3K), transcript variant X1, mRNA. On-demand $399.00 14
Title The translation initiation factor 3 subunit eIF3K interacts with .
Author Salsman J, Pinder J, Tse B, Corkery D and Dellaire G.
Journal Exp. Cell Res. 319 (17), 2554-2565 (2013)
Title Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3 .
Author Zhou M, Sandercock AM, Fraser CS, Ridlova G, Stephens E, Schenauer MR, Yokoi-Fong T, Barsky D, Leary JA, Hershey JW, Doudna JA and Robinson CV.
Journal Proc. Natl. Acad. Sci. U.S.A. 105 (47), 18139-18144 (2008)
Title eIF3k regulates apoptosis in epithelial cells by releasing caspase 3 from keratin-containing inclusions .
Author Lin YM, Chen YR, Lin JR, Wang WJ, Inoko A, Inagaki M, Wu YC and Chen RH.
Journal J. Cell. Sci. 121 (PT 14), 2382-2393 (2008)
Title Reconstitution reveals the functional core of mammalian eIF3 .
Author Masutani M, Sonenberg N, Yokoyama S and Imataka H.
Journal EMBO J. 26 (14), 3373-3383 (2007)
Title Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry .
Author Damoc E, Fraser CS, Zhou M, Videler H, Mayeur GL, Hershey JW, Doudna JA, Robinson CV and Leary JA.
Journal Mol. Cell Proteomics 6 (7), 1135-1146 (2007)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch P, Li N, Milstein S, Fan C, Hao T, Szabo G, Hu Z, Venkatesan K, Bethel G, Martin P, Rogers J, Lawlor S, McLaren S, Dricot A, Borick H, Cusick ME, Vandenhaute J, Dunham I, Hill DE and Vidal M.
Journal Genomics 89 (3), 307-315 (2007)
Title Identification of the p28 subunit of eukaryotic initiation factor 3(eIF3k) as a new interaction partner of cyclin D3 .
Author Shen X, Yang Y, Liu W, Sun M, Jiang J, Zong H and Gu J.
Journal FEBS Lett. 573 (1-3), 139-146 (2004)
Title Crystal structure of human eIF3k, the first structure of eIF3 subunits .
Author Wei Z, Zhang P, Zhou Z, Cheng Z, Wan M and Gong W.
Journal J. Biol. Chem. 279 (33), 34983-34990 (2004)
Title Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor elF3 .
Author Mayeur GL, Fraser CS, Peiretti F, Block KL and Hershey JW.
Journal Eur. J. Biochem. 270 (20), 4133-4139 (2003)
Title Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region .
Author Sampath P, Mazumder B, Seshadri V and Fox PL.
Journal Mol. Cell. Biol. 23 (5), 1509-1519 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.