• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16287 Homo sapiens cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu16287C Homo sapiens cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_013246.2, 50726992
Length 678 bp
Structure linear
Update Date 19-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 1, mRNA.
Product cardiotrophin-like cytokine factor 1 isoform 1 precursor
Comment

Summary: This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009].


Transcript Variant: This variant (1) encodes the longer isoform (1). Though this isoform has a predicted signal peptide at amino acids 1-27, experiments show it is retained within the cell.

RefSeq NP_037378.1
CDS 197..874
Misc Feature(1)110..112
Misc Feature(2)<362..832
Exon (1)1..212
Gene:CLCF1
Gene Synonym:BSF-3; BSF3; CISS2; CLC; NNT-1; NNT1; NR6
Exon (2)213..379
Gene:CLCF1
Gene Synonym:BSF-3; BSF3; CISS2; CLC; NNT-1; NNT1; NR6
Exon (3)380..1842
Gene:CLCF1
Gene Synonym:BSF-3; BSF3; CISS2; CLC; NNT-1; NNT1; NR6
Translation MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGT YLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGL NRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQ KMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(22..23)-dbSNP:
complement(22..23)-, tdbSNP:35544864
complement(176)-g, cdbSNP:112054504
complement(220)-dbSNP:
complement(220)-t, cdbSNP:141954460
complement(224)-t, cdbSNP:145282707
complement(225)-t, cdbSNP:140222264
complement(234)-g, adbSNP:369213496
complement(235)-t, cdbSNP:376191009
242+c, tdbSNP:137853934
complement(247)-t, cdbSNP:200379623
complement(284)-g, adbSNP:76168219
complement(300)-c, adbSNP:184518539
complement(304)-t, adbSNP:867193
complement(308)-g, adbSNP:140759579
complement(336)-g, cdbSNP:201269564
complement(338)-g, adbSNP:372255151
complement(339)-t, cdbSNP:369594545
complement(375)-g, adbSNP:137879055
complement(429)-dbSNP:
complement(429)-t, cdbSNP:145294376
complement(437)-t, cdbSNP:140383361
complement(472)-t, cdbSNP:145660153
complement(475)-t, cdbSNP:367649677
complement(487)-g, adbSNP:150131356
517+a, cdbSNP:104894198
complement(548)-g, adbSNP:368762582
complement(554)-g, adbSNP:140841317
complement(558)-t, cdbSNP:371858892
complement(561)-t, cdbSNP:151050272
complement(584)-g, adbSNP:142875118
complement(587)-g, adbSNP:140020543
complement(588)-t, cdbSNP:34057094
complement(629)-g, cdbSNP:375238966
complement(640)-t, cdbSNP:147960206
complement(644)-t, cdbSNP:373018736
complement(652)-t, cdbSNP:369389500
complement(677)-g, adbSNP:78755659
complement(678)-g, adbSNP:140991132
complement(680)-g, adbSNP:144403804
complement(683)-g, adbSNP:376016004
complement(696)-g, cdbSNP:149603003
complement(785)-g, cdbSNP:76654399
786+g, tdbSNP:104894203
complement(804)-t, cdbSNP:369390178
complement(833)-g, cdbSNP:374786448
complement(851)-g, adbSNP:139364696
complement(856..862)-, agcccccdbSNP:140997186
872+c, tdbSNP:137853935
complement(877)-t, adbSNP:368623631
complement(894)-g, adbSNP:370600571
complement(895)-t, cdbSNP:376316748
complement(1001)-t, cdbSNP:116002422
complement(1018)-t, cdbSNP:73503948
complement(1056)-g, adbSNP:72932728
complement(1116)-g, adbSNP:200395167
complement(1129..1130)-, atctctgcaccaacctgaaccacdbSNP:373822867
complement(1417)-t, cdbSNP:148796566
complement(1481..1482)-, ggtctdbSNP:370050571
complement(1482..1483)-, ggtctdbSNP:200359845
complement(1519..1520)-, gdbSNP:35385218
complement(1520)-g, cdbSNP:144359415
complement(1593)-g, cdbSNP:184926921
complement(1629..1630)-, adbSNP:140450526
complement(1703)-, cdbSNP:35896036
Gene SymbolCLCF1
Gene SynonymBSF-3; BSF3; CISS2; CLC; NNT-1; NNT1; NR6
Chromosome11
Locus Map11q13.3
Title Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chain .
Author Rousseau F, Chevalier S, Guillet C, Ravon E, Diveu C, Froger J, Barbier F, Grimaud L and Gascan H.
Journal J. Biol. Chem. 283 (44), 30341-30350 (2008)
Title Mutations in cytokine receptor-like factor 1 (CRLF1) account for both Crisponi and cold-induced sweating syndromes .
Author Dagoneau N, Bellais S, Blanchet P, Sarda P, Al-Gazali LI, Di Rocco M, Huber C, Djouadi F, Le Goff C, Munnich A and Cormier-Daire V.
Journal Am. J. Hum. Genet. 80 (5), 966-970 (2007)
Title Inactivation of cardiotrophin-like cytokine, a second ligand for ciliary neurotrophic factor receptor, leads to cold-induced sweating syndrome in a patient .
Author Rousseau F, Gauchat JF, McLeod JG, Chevalier S, Guillet C, Guilhot F, Cognet I, Froger J, Hahn AF, Knappskog PM, Gascan H and Boman H.
Journal Proc. Natl. Acad. Sci. U.S.A. 103 (26), 10068-10073 (2006)
Title Transcriptome analysis of human gastric cancer .
Author Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS and Kim NS.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Two different contact sites are recruited by cardiotrophin-like cytokine (CLC) to generate the CLC/CLF and CLC/sCNTFRalpha composite cytokines .
Author Perret D, Guillet C, Elson G, Froger J, Plun-Favreau H, Rousseau F, Chabbert M, Gauchat JF and Gascan H.
Journal J. Biol. Chem. 279 (42), 43961-43970 (2004)
Title The ciliary neurotrophic factor receptor alpha component induces the secretion of and is required for functional responses to cardiotrophin-like cytokine .
Author Plun-Favreau H, Elson G, Chabbert M, Froger J, deLapeyriere O, Lelievre E, Guillet C, Hermann J, Gauchat JF, Gascan H and Chevalier S.
Journal EMBO J. 20 (7), 1692-1703 (2001)
Title CLF associates with CLC to form a functional heteromeric ligand for the CNTF receptor complex .
Author Elson GC, Lelievre E, Guillet C, Chevalier S, Plun-Favreau H, Froger J, Suard I, de Coignac AB, Delneste Y, Bonnefoy JY, Gauchat
Journal Nat. Neurosci. 3 (9), 867-872 (2000)
Title Novel neurotrophin-1/B cell-stimulating factor-3: a cytokine of the IL-6 family .
Author Senaldi G, Varnum BC, Sarmiento U, Starnes C, Lile J, Scully S, Guo J, Elliott G, McNinch J, Shaklee CL, Freeman D, Manu F, Simonet WS, Boone T and Chang MS.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (20), 11458-11463 (1999)
Title Computational EST database analysis identifies a novel member of the neuropoietic cytokine family .
Author Shi Y, Wang W, Yourey PA, Gohari S, Zukauskas D, Zhang J, Ruben S and Alderson RF.
Journal Biochem. Biophys. Res. Commun. 262 (1), 132-138 (1999)
Title Cold-Induced Sweating Syndrome including Crisponi Syndrome .
Author Hahn,A.F. and Boman,H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.