• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_013265 Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_013265.3, 429903861
Length 2761 bp
Structure linear
Update Date 15-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA.
Product vacuolar protein sorting-associated protein 51 homolog
Comment

Summary: This gene encodes a member of the vacuolar protein sorting-associated protein 51 family. The encoded protein is a component of the Golgi-associated retrograde protein complex which acts as a tethering factor for carriers in retrograde transport from the early and late endosomes to the trans-Golgi network. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012].


Transcript Variant: This variant (1) represents the shorter transcript and encodes the functional protein.


##Evidence-Data-START## Transcript exon combination :: AF024631.2, BC010540.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##


##RefSeq-Attributes-START## CDS uses downstream in-frame AUG :: upstream AUG and CDS extension is not conserved ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_037397.2
CDS 137..2485
Misc Feature(1)140..142
Misc Feature(2)140..142
Misc Feature(3)188..190
Misc Feature(4)323..580
Misc Feature(5)437..922
Exon (1)1..364
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (2)365..494
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (3)495..641
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (4)642..861
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (5)862..1579
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (6)1580..1795
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (7)1796..2014
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (8)2015..2136
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (9)2137..2224
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (10)2225..2758
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Translation MAAAAAAGPSPGSGPGDSPEGPEGEAPERRRKAHGMLKLYYGLSEGEAAGRPAGPDPLDP TDLNGAHFDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATD TIRKMKNDFRKMEDEMDRLATNMAVITDFSARISATLQDRHERITKLAGVHALLRKLQFL FELPSRLTKCVELGAYGQAVRYQGRAQAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQR FREGGSGAPEQAECVELLLALGEPAEELCEEFLAHARGRLEKELRNLEAELGPSPPAPDV LEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQ GGGDNSLLVRALDRFHRRLRAPGALLAAAGLADAATEIVERVARERLGHHLQGLRAAFLG CLTDVRQALAAPRVAGKEGPGLAELLANVASSILSHIKASLAAVHLFTAKEVSFSNKPYF RGEFCSQGVREGLIVGFVHSMCQTAQSFCDSPGEKGGATPPALLLLLSRLCLDYETATIS YILTLTDEQFLVQDQFPVTPVSTLCAEARETARRLLTHYVKVQGLVISQMLRKSVETRDW LSTLEPRNVRAVMKRVVEDTTAIDVQVGLLYEEGVRKAQSSDSSKRTFSVYSSSRQQGRY APSYTPSAPMDTNLLSNIQKLFSERIDVFSPVEFNKVSVLTGIIKISLKTLLECVRLRTF GRFGLQQVQVDCHFLQLYLWRFVADEELVHLLLDEVVASAALRCPDPVPMEPSVVEVICE RG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
43+dbSNP:
43+a, gdbSNP:116522417
181+c, tdbSNP:11548900
182+, gdbSNP:36115087
205+a, gdbSNP:184045929
283+a, gdbSNP:375407505
323+c, gdbSNP:199696581
377+dbSNP:
377+g, tdbSNP:140845832
443+a, gdbSNP:377434441
490+a, cdbSNP:11548901
499+dbSNP:
499+c, tdbSNP:111582719
556+c, tdbSNP:144604807
560+a, gdbSNP:371673983
576+c, tdbSNP:138611642
611+a, gdbSNP:373727258
619+c, gdbSNP:375116322
649+dbSNP:
649+c, tdbSNP:376863195
655+a, gdbSNP:368671829
660+a, gdbSNP:141196474
668+c, tdbSNP:371725117
685+a, gdbSNP:150314788
706+c, tdbSNP:200666496
761+a, gdbSNP:137860347
781+a, cdbSNP:377180594
790+c, gdbSNP:370039927
795+a, gdbSNP:373496992
832+c, gdbSNP:377335542
833+a, cdbSNP:201701443
922+dbSNP:
922+c, tdbSNP:369451466
933+a, gdbSNP:372724187
943+c, tdbSNP:375984174
955+a, gdbSNP:370063968
958+c, gdbSNP:201975905
1075+c, tdbSNP:138904279
1086+a, gdbSNP:202137528
1118+a, gdbSNP:373776274
1125+g, tdbSNP:375782577
1136+g, tdbSNP:371442252
1157+g, tdbSNP:11548902
1170+c, gdbSNP:199798147
1303+c, tdbSNP:145959966
1353+g, tdbSNP:374731060
1393+c, gdbSNP:368202102
1435+c, gdbSNP:201622389
1465+c, gdbSNP:149391431
1492+c, tdbSNP:144845424
1500+a, gdbSNP:140186079
1506+c, tdbSNP:201089305
1540+c, tdbSNP:373780734
1576+c, tdbSNP:143862116
1618+dbSNP:
1618+c, gdbSNP:147241001
1629+c, tdbSNP:372048283
1639+g, tdbSNP:376718956
1647+c, tdbSNP:140677028
1663+c, tdbSNP:200471797
1681+a, gdbSNP:369231552
1721+c, tdbSNP:372980301
1743+c, tdbSNP:142361493
1744+a, gdbSNP:376252985
1751+a, gdbSNP:199595884
1789+g, tdbSNP:151261210
1804+dbSNP:
1804+c, tdbSNP:139872576
1812+c, tdbSNP:139150785
1816+c, tdbSNP:61736623
1819+c, gdbSNP:146532296
1837+g, tdbSNP:141095389
1853+c, tdbSNP:144624856
1854+a, gdbSNP:146670601
1857+a, gdbSNP:375386887
1873+c, tdbSNP:377010488
1874+a, gdbSNP:148816548
1889+a, cdbSNP:370861729
1894+c, tdbSNP:370597813
1904+a, tdbSNP:143500542
1918+c, tdbSNP:191494770
1937+a, cdbSNP:200709758
complement(1967)-t, gdbSNP:77671913
1979+c, tdbSNP:201155694
2000+c, gdbSNP:543294
2005+c, tdbSNP:147997133
2039+dbSNP:
2039+a, gdbSNP:115159943
2090+a, gdbSNP:147082259
2122+c, gdbSNP:75866301
2124+a, gdbSNP:200696699
2142+dbSNP:
2142+c, gdbSNP:372760329
2152+c, tdbSNP:192420080
2205+c, gdbSNP:138579763
2275+dbSNP:
2275+a, gdbSNP:377108289
2285+c, tdbSNP:367917809
2305+c, tdbSNP:190333280
2309+c, tdbSNP:371792750
2318+g, tdbSNP:144112052
2350+c, tdbSNP:375813533
2358+a, gdbSNP:147317726
2368+c, tdbSNP:139692151
2380+c, tdbSNP:373911021
2500+a, gdbSNP:369679151
2504+a, gdbSNP:372710325
2505+c, tdbSNP:375268787
2519+c, tdbSNP:117099117
2521+c, tdbSNP:201922501
2605+a, tdbSNP:3180595
Gene SymbolVPS51
Gene SynonymANG2; ANG3; C11orf2; C11orf3; FFR
Chromosome11
Locus Map11q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_013265 Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA. In-stock $809.00 $760.00 15
Title Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6 .
Author Abascal-Palacios G, Schindler C, Rojas AL, Bonifacino JS and Hierro A.
Journal Structure 21 (9), 1698-1706 (2013)
Title Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex .
Author Perez-Victoria FJ, Schindler C, Magadan JG, Mardones GA, Delevoye C, Romao M, Raposo G and Bonifacino JS.
Journal Mol. Biol. Cell 21 (19), 3386-3395 (2010)
Title Construction of a 1.2-Mb sequence-ready contig of chromosome 11q13 encompassing the multiple endocrine neoplasia type 1 (MEN1) gene. The European Consortium on MEN1 .
Author Lemmens,I., Merregaert,J., Van de Ven,W.J., Kas,K., Zhang,C.X., Giraud,S., Wautot,V., Buisson,N., De Witte,K., Salandre,J., Lenoir,G., Calender,A., Parente,F., Quincey,D., Courseaux,A., Carle,G.F., Gaudray,P., De Wit,M.J., Lips,C.J., Hoppener,J.W., Khodaei,S., Grant,A.L., Weber,G., Kytola,S., Thakker,R.V. et al.
Journal Genomics 44 (1), 94-100 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.