• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_013265 Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA. ORF Sequence $681.21
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_013265.3, 429903861
Length 2761 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA.
Product vacuolar protein sorting-associated protein 51 homolog
Comment

Summary: This gene encodes a member of the vacuolar protein sorting-associated protein 51 family. The encoded protein is a component of the Golgi-associated retrograde protein complex which acts as a tethering factor for carriers in retrograde transport from the early and late endosomes to the trans-Golgi network. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012].


Transcript Variant: This variant (1) represents the shorter transcript and encodes the functional protein.


##Evidence-Data-START## Transcript exon combination :: AF024631.2, BC010540.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_037397.2
CDS 137..2485
Misc Feature(1)188..190
Misc Feature(2)188..190
Misc Feature(3)323..580
Exon (1)1..364
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (2)365..494
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (3)495..641
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (4)642..861
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (5)862..1579
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (6)1580..1795
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (7)1796..2014
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (8)2015..2136
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (9)2137..2224
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Exon (10)2225..2758
Gene:VPS51
Gene Synonym:ANG2; ANG3; C11orf2; C11orf3; FFR
Translation MAAAAAAGPSPGSGPGDSPEGPEGEAPERRRKAHGMLKLYYGLSEGEAAGRPAGPDPLDP TDLNGAHFDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATD TIRKMKNDFRKMEDEMDRLATNMAVITDFSARISATLQDRHERITKLAGVHALLRKLQFL FELPSRLTKCVELGAYGQAVRYQGRAQAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQR FREGGSGAPEQAECVELLLALGEPAEELCEEFLAHARGRLEKELRNLEAELGPSPPAPDV LEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQ GGGDNSLLVRALDRFHRRLRAPGALLAAAGLADAATEIVERVARERLGHHLQGLRAAFLG CLTDVRQALAAPRVAGKEGPGLAELLANVASSILSHIKASLAAVHLFTAKEVSFSNKPYF RGEFCSQGVREGLIVGFVHSMCQTAQSFCDSPGEKGGATPPALLLLLSRLCLDYETATIS YILTLTDEQFLVQDQFPVTPVSTLCAEARETARRLLTHYVKVQGLVISQMLRKSVETRDW LSTLEPRNVRAVMKRVVEDTTAIDVQVGLLYEEGVRKAQSSDSSKRTFSVYSSSRQQGRY APSYTPSAPMDTNLLSNIQKLFSERIDVFSPVEFNKVSVLTGIIKISLKTLLECVRLRTF GRFGLQQVQVDCHFLQLYLWRFVADEELVHLLLDEVVASAALRCPDPVPMEPSVVEVICE RG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolVPS51
Gene SynonymANG2; ANG3; C11orf2; C11orf3; FFR
Chromosome11
Locus Map11q13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_013265 Homo sapiens vacuolar protein sorting 51 homolog (S. cerevisiae) (VPS51), transcript variant 1, mRNA. Full Length $800.69
ORF Sequence $681.21
Title Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex .
Author Perez-Victoria,F.J., Schindler,C., Magadan,J.G., Mardones,G.A., Delevoye,C., Romao,M., Raposo,G. and Bonifacino,J.S.
Journal Mol. Biol. Cell 21 (19), 3386-3395 (2010)
Title Construction of a 1.2-Mb sequence-ready contig of chromosome 11q13 encompassing the multiple endocrine neoplasia type 1 (MEN1) gene. The European Consortium on MEN1 .
Author Lemmens,I., Merregaert,J., Van de Ven,W.J., Kas,K., Zhang,C.X., Giraud,S., Wautot,V., Buisson,N., De Witte,K., Salandre,J., Lenoir,G., Calender,A., Parente,F., Quincey,D., Courseaux,A., Carle,G.F., Gaudray,P., De Wit,M.J., Lips,C.J., Hoppener,J.W., Khodaei,S., Grant,A.L., Weber,G., Kytola,S., Thakker,R.V. et al.
Journal Genomics 44 (1), 94-100 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878