• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens eukaryotic elongation factor-2 kinase (EEF2K), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu13523 Homo sapiens eukaryotic elongation factor-2 kinase (EEF2K), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu13523C Homo sapiens eukaryotic elongation factor-2 kinase (EEF2K), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_013302.3, 89903005
Length 2178 bp
Structure linear
Update Date 23-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens eukaryotic elongation factor-2 kinase (EEF2K), mRNA.
Product eukaryotic elongation factor 2 kinase
Comment

Summary: This gene encodes a highly conserved protein kinase in the calmodulin-mediated signaling pathway that links activation of cell surface receptors to cell division. This kinase is involved in the regulation of protein synthesis. It phosphorylates eukaryotic elongation factor 2 (EEF2) and thus inhibits the EEF2 function. The activity of this kinase is increased in many cancers and may be a valid target for anti-cancer treatment. [provided by RefSeq, Jul 2008].

RefSeq NP_037434.1
CDS 486..2663
Misc Feature(1)465..467
Misc Feature(2)489..491
Misc Feature(3)489..491
Misc Feature(4)537..539
Misc Feature(5)537..539
Misc Feature(6)537..539
Misc Feature(7)564..566
Misc Feature(8)576..578
Misc Feature(9)666..668
Misc Feature(10)681..683
Misc Feature(11)690..692
Misc Feature(12)693..695
Misc Feature(13)717..719
Misc Feature(14)717..719
Misc Feature(15)717..719
Misc Feature(16)846..1439
Misc Feature(17)1527..1529
Misc Feature(18)1542..1544
Misc Feature(19)1560..1562
Misc Feature(20)1560..1562
Misc Feature(21)1581..1583
Misc Feature(22)1581..1583
Misc Feature(23)1581..1583
Misc Feature(24)1581..1583
Misc Feature(25)1581..1583
Misc Feature(26)1581..1583
Misc Feature(27)1614..1616
Misc Feature(28)1614..1616
Misc Feature(29)1614..1616
Misc Feature(30)1671..1673
Misc Feature(31)1671..1673
Misc Feature(32)1671..1673
Misc Feature(33)1671..1673
Misc Feature(34)1671..1673
Misc Feature(35)1671..1673
Misc Feature(36)1677..1679
Misc Feature(37)1677..1679
Misc Feature(38)1677..1679
Misc Feature(39)1818..1820
Misc Feature(40)1893..1895
Misc Feature(41)1893..1895
Misc Feature(42)1905..1907
Misc Feature(43)1905..1907
Misc Feature(44)1914..1916
Misc Feature(45)1956..1958
Misc Feature(46)1983..1985
Misc Feature(47)2082..>2624
Misc Feature(48)2265..2315
Misc Feature(49)2313..2366
Exon (1)1..409
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (2)410..731
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (3)732..832
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (4)833..893
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (5)894..931
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (6)932..1103
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (7)1104..1253
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (8)1254..1386
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (9)1387..1514
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (10)1515..1716
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (11)1717..1784
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (12)1785..1862
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (13)1863..1925
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (14)1926..2060
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (15)2061..2249
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (16)2250..2374
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (17)2375..2553
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Exon (18)2554..7412
Gene:EEF2K
Gene Synonym:eEF-2K; HSU93850
Translation MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW AQMEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
153+dbSNP:
153+a, gdbSNP:374884794
207+a, gdbSNP:181260490
243+a, gdbSNP:148149454
289+c, tdbSNP:370724289
308+a, gdbSNP:186505381
366+c, tdbSNP:190982782
417+dbSNP:
417+a, gdbSNP:141957651
474+a, cdbSNP:145675806
504+a, gdbSNP:191219230
510+c, tdbSNP:146984360
539+c, tdbSNP:147612457
547+c, gdbSNP:142308079
553+a, gdbSNP:9935059
573+a, gdbSNP:377003950
578+c, tdbSNP:148266060
625+g, tdbSNP:201901191
643+a, gdbSNP:201562293
657+a, gdbSNP:201214793
681+a, cdbSNP:141159782
687+c, tdbSNP:374450826
702+a, gdbSNP:183827430
703+a, gdbSNP:367751749
708+c, gdbSNP:17841292
710+a, gdbSNP:376491451
728+a, cdbSNP:368106187
746+dbSNP:
746+c, tdbSNP:200566569
753+c, tdbSNP:137985480
842+dbSNP:
842+c, tdbSNP:200700399
848+c, gdbSNP:199516774
849+a, gdbSNP:367549911
899+dbSNP:
899+c, tdbSNP:55742485
918+a, gdbSNP:373246459
931+c, tdbSNP:149482446
954+dbSNP:
954+a, cdbSNP:373222313
955+a, gdbSNP:146134752
959+c, tdbSNP:377653714
973+g, tdbSNP:145216064
complement(974)-t, gdbSNP:2303186
986+c, tdbSNP:55959085
992+a, gdbSNP:146399588
1001+c, tdbSNP:377747666
1005+a, gdbSNP:148576611
1010+c, tdbSNP:141676543
1018+a, gdbSNP:191986675
1037+c, tdbSNP:142805417
1042+a, gdbSNP:151023929
1057+a, cdbSNP:200577173
1066+c, gdbSNP:139820091
1067+c, gdbSNP:376970159
1071+a, gdbSNP:144705546
1085+a, gdbSNP:370520965
1125+dbSNP:
1125+a, cdbSNP:147220043
1129+c, tdbSNP:369121898
1131+a, gdbSNP:147622817
1147+c, tdbSNP:138681546
1148+a, gdbSNP:112106407
1161+c, tdbSNP:113328768
1173+a, cdbSNP:376152548
1182+a, gdbSNP:145917206
1198+a, gdbSNP:370034799
1224+c, tdbSNP:145636251
1226+c, tdbSNP:200654228
1247+a, gdbSNP:376210463
1249+c, tdbSNP:148891591
1253+a, gdbSNP:371109837
1279+dbSNP:
1279+a, gdbSNP:143471765
1284+a, gdbSNP:371880159
1305+g, tdbSNP:376499773
1346+a, cdbSNP:191221379
1356+a, gdbSNP:368114040
1357+c, tdbSNP:147978363
1358+a, gdbSNP:140938002
1376+c, tdbSNP:201261698
1392+dbSNP:
1392+c, tdbSNP:375672467
1402+c, tdbSNP:144649581
1403+a, gdbSNP:371051169
1429+a, gdbSNP:201478126
1431+c, tdbSNP:374213806
1432+a, gdbSNP:200860088
1439+c, tdbSNP:191224579
1451+c, tdbSNP:200682384
1466+a, cdbSNP:367547589
1472+a, gdbSNP:375118137
1474+c, tdbSNP:199872165
1477+a, gdbSNP:201425454
1487+g, tdbSNP:115145983
1508+a, gdbSNP:182626846
1519+dbSNP:
1519+c, tdbSNP:142158605
1521+a, gdbSNP:200714248
1529+a, cdbSNP:200099793
1530+a, gdbSNP:372222067
1543+c, tdbSNP:374751930
1554+c, tdbSNP:201198682
1566+c, tdbSNP:368839566
1567+a, gdbSNP:4783453
1591+a, gdbSNP:201576066
1592+c, gdbSNP:138328974
1605+c, tdbSNP:183300451
1606+a, gdbSNP:149639518
1627+c, gdbSNP:377220765
1631+a, cdbSNP:187968648
1643+c, tdbSNP:144252213
1655+c, tdbSNP:148711774
1681+c, tdbSNP:201712494
1697+c, g, tdbSNP:144592275
1716+c, tdbSNP:200544061
1760+dbSNP:
1760+a, cdbSNP:147488019
1782+c, tdbSNP:56137739
1783+a, gdbSNP:200367551
1785+dbSNP:
1785+g, tdbSNP:139935693
1787+a, gdbSNP:201706454
1809+a, gdbSNP:200745885
1827+c, tdbSNP:151195585
1830+a, gdbSNP:140413530
1852+a, cdbSNP:369790027
1865+dbSNP:
1865+c, tdbSNP:368396226
1882+a, gdbSNP:370825774
1886+a, gdbSNP:374240621
1889+c, tdbSNP:368773676
1915+a, gdbSNP:149952776
1932+dbSNP:
1932+a, gdbSNP:113967917
1959+c, tdbSNP:201318133
1963+a, g, tdbSNP:144906808
1985+a, gdbSNP:140822355
1989+a, gdbSNP:200096701
2009+a, gdbSNP:144576006
2012+c, tdbSNP:138596775
2039+c, tdbSNP:140262714
2080+dbSNP:
2080+a, gdbSNP:374386704
2088+a, gdbSNP:148136135
2093+c, tdbSNP:142023591
2098+a, gdbSNP:370102420
2105+c, tdbSNP:36095301
2114+c, tdbSNP:200275873
2115+a, gdbSNP:139314427
2120+g, tdbSNP:143012622
2156+c, tdbSNP:147445610
2196+a, gdbSNP:140031125
2210+a, g, tdbSNP:150007908
2224+a, tdbSNP:144564995
2233+c, tdbSNP:377007257
2235+a, gdbSNP:148449057
2278+dbSNP:
2278+g, tdbSNP:199875946
2289+c, tdbSNP:373007384
2298+a, gdbSNP:79450430
2310+a, gdbSNP:55982915
2352+a, gdbSNP:151013717
2356+a, g, tdbSNP:34284811
2368+c, tdbSNP:370431079
2369+a, gdbSNP:55713051
2378+dbSNP:
2378+c, tdbSNP:143168138
2391+a, gdbSNP:200181029
2392+a, cdbSNP:369477263
2425+c, tdbSNP:373972090
2428+c, tdbSNP:143443395
2468+c, tdbSNP:140310220
2469+a, gdbSNP:186100609
2475+c, tdbSNP:200375331
2476+a, gdbSNP:189363550
2515+c, tdbSNP:199731019
2525+c, tdbSNP:150317840
2526+a, gdbSNP:146761211
2542+c, tdbSNP:370030748
2559+dbSNP:
2559+c, tdbSNP:149196143
2570+c, gdbSNP:369023767
2581+a, gdbSNP:111578333
2623+a, gdbSNP:143321413
2657+a, gdbSNP:189399872
2680+c, tdbSNP:200860995
2721+a, cdbSNP:180920116
2722..2724+, aacdbSNP:367584480
2777+c, tdbSNP:139900821
2914+c, tdbSNP:371402786
2929+a, gdbSNP:35099626
2945+g, tdbSNP:367622128
2984+g, tdbSNP:141771461
3033+c, tdbSNP:186113573
3190..3191+, cdbSNP:34789213
3197+c, tdbSNP:77312693
3237+c, tdbSNP:370756801
3244+a, gdbSNP:189350285
3291+a, cdbSNP:201744043
3299..3300+, atdbSNP:202053603
3302..3305+aa, taagdbSNP:386789750
3302+, tdbSNP:200359014
complement(3305)-t, cdbSNP:200345830
3305+, gdbSNP:201707225
3312..3313+, cdbSNP:35328474
3319+c, tdbSNP:181362360
3323+c, gdbSNP:185853475
3363+a, gdbSNP:146251353
3378+c, tdbSNP:191745919
3423+a, gdbSNP:139191619
3451+c, tdbSNP:149967776
3451+c, tdbSNP:386468309
3809+c, gdbSNP:9938722
complement(3832)-t, gdbSNP:2290829
3884+a, cdbSNP:183203156
complement(3949)-g, adbSNP:2290828
4307+c, tdbSNP:80276174
4323+c, tdbSNP:73539817
4366+a, tdbSNP:62044794
4450+a, gdbSNP:145192626
4469+c, tdbSNP:376339455
4481+g, tdbSNP:148717671
4520..4522+, ttadbSNP:138130108
4544+a, cdbSNP:186483440
4552+a, gdbSNP:190927150
4580+c, tdbSNP:182350887
4581+a, gdbSNP:187725588
4625+c, tdbSNP:144678317
4846+a, gdbSNP:192538779
4907..4908+, tgdbSNP:150357370
4922+a, gdbSNP:78878785
complement(4928)-t, gdbSNP:147906990
4951+c, tdbSNP:183593878
4958+c, tdbSNP:188631379
5232..5233+, aaaaaacdbSNP:147171947
5244+a, cdbSNP:1130205
5321+c, tdbSNP:192974872
5333+c, tdbSNP:141720187
5347+g, tdbSNP:13313556
5355+a, gdbSNP:184772226
5361+c, tdbSNP:79468223
5498+a, cdbSNP:372695402
5552..5553+, tdbSNP:34545250
5562+a, gdbSNP:188034753
5623+a, gdbSNP:368899309
5628+a, gdbSNP:368433997
5738+a, cdbSNP:118120368
5766+a, gdbSNP:147081843
5925+g, tdbSNP:8051513
5927+c, tdbSNP:141097845
6063+a, gdbSNP:114526855
6286+g, tdbSNP:137864990
complement(6319)-g, adbSNP:142370473
6534+a, gdbSNP:191115121
6656..6657+, ttdbSNP:72018569
6671..6674+, ttttdbSNP:57315187
6773+c, tdbSNP:11863455
6849+a, gdbSNP:111914267
6960+g, tdbSNP:138573523
6976+a, tdbSNP:183623011
complement(7217)-g, adbSNP:144543601
Gene SymbolEEF2K
Gene SynonymeEF-2K; HSU93850
Chromosome16
Locus Map16p12.2
Title Eukaryotic elongation factor 2 kinase regulates the development of hypertension through oxidative stress-dependent vascular inflammation .
Author Usui T, Okada M, Hara Y and Yamawaki H.
Journal Am. J. Physiol. Heart Circ. Physiol. 305 (5), H756-H768 (2013)
Title The eEF2 kinase confers resistance to nutrient deprivation by blocking translation elongation .
Author Leprivier G, Remke M, Rotblat B, Dubuc A, Mateo AR, Kool M, Agnihotri S, El-Naggar A, Yu B, Somasekharan SP, Faubert B, Bridon G, Tognon CE, Mathers J, Thomas R, Li A, Barokas A, Kwok B, Bowden M, Smith S, Wu X, Korshunov A, Hielscher T, Northcott PA, Galpin JD, Ahern CA, Wang Y, McCabe MG, Collins VP, Jones RG, Pollak M, Delattre O, Gleave ME, Jan E, Pfister SM, Proud CG, Derry WB, Taylor MD and Sorensen PH.
Journal Cell 153 (5), 1064-1079 (2013)
Title Phosphorylation of eukaryotic elongation factor 2 (eEF2) by cyclin A-cyclin-dependent kinase 2 regulates its inhibition by eEF2 kinase .
Author Hizli AA, Chi Y, Swanger J, Carter JH, Liao Y, Welcker M, Ryazanov
Journal Mol. Cell. Biol. 33 (3), 596-604 (2013)
Title Roles of eEF-2 kinase in cancer .
Author Liu XY, Zhang L, Zhang Y and Yang JM.
Journal Chin. Med. J. 125 (16), 2908-2913 (2012)
Title Targeted silencing of elongation factor 2 kinase suppresses growth and sensitizes tumors to doxorubicin in an orthotopic model of breast cancer .
Author Tekedereli I, Alpay SN, Tavares CD, Cobanoglu ZE, Kaoud TS, Sahin I, Sood AK, Lopez-Berestein G, Dalby KN and Ozpolat B.
Journal PLoS ONE 7 (7), E41171 (2012)
Title Phosphorylation of elongation factor-2 kinase on serine 499 by cAMP-dependent protein kinase induces Ca2+/calmodulin-independent activity .
Author Diggle TA, Subkhankulova T, Lilley KS, Shikotra N, Willis AE and Redpath NT.
Journal Biochem. J. 353 (PT 3), 621-626 (2001)
Title Mapping the functional domains of elongation factor-2 kinase .
Author Pavur KS, Petrov AN and Ryazanov AG.
Journal Biochemistry 39 (40), 12216-12224 (2000)
Title Identification of a new class of protein kinases represented by eukaryotic elongation factor-2 kinase .
Author Ryazanov AG, Ward MD, Mendola CE, Pavur KS, Dorovkov MV, Wiedmann M, Erdjument-Bromage H, Tempst P, Parmer TG, Prostko CR, Germino FJ and Hait WN.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (10), 4884-4889 (1997)
Title Regulation of elongation factor-2 by multisite phosphorylation .
Author Redpath NT, Price NT, Severinov KV and Proud CG.
Journal Eur. J. Biochem. 213 (2), 689-699 (1993)
Title Identification of the major Mr 100,000 substrate for calmodulin-dependent protein kinase III in mammalian cells as elongation factor-2 .
Author Nairn AC and Palfrey HC.
Journal J. Biol. Chem. 262 (36), 17299-17303 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.