• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA.


RefSeq Accession Definition Services Price Order
NM_013995 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA. ORF Sequence $357.57
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_013995.2, 169790831
Length 4076 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA.
Product lysosome-associated membrane glycoprotein 2 isoform B precursor
Comment

Summary: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (B) results from alternative splicing of exon 9 and results in a shorter transcript, but not protein, as compared to variant A. Transcript variant B is over-expressed in muscle and encodes isoform B.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_054701.1
CDS 181..1413
Misc Feature(1)37..39
Misc Feature(2)37..39
Misc Feature(3)274..276
Misc Feature(4)292..294
Misc Feature(5)325..327
Misc Feature(6)352..354
Misc Feature(7)505..1410
Misc Feature(8)763..765
Misc Feature(9)766..768
Misc Feature(10)778..780
Misc Feature(11)787..789
Misc Feature(12)790..792
Misc Feature(13)799..801
Misc Feature(14)805..807
Misc Feature(15)808..810
Misc Feature(16)811..813
Misc Feature(17)904..906
Misc Feature(18)1099..1101
Exon (1)1..244
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (2)245..363
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (3)364..577
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (4)578..736
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (5)737..921
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (6)922..1044
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (7)1045..1108
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (8)1109..1273
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (9)1274..4073
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Translation MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKT YKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNT GDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNG TVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQ LNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN ISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQG KYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVIAYVIGRRKSYAGYQTL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(43)-c, adbSNP:144321444
complement(46)-t, cdbSNP:181118176
complement(81)-t, cdbSNP:188688129
complement(158..166)-, gtcgccgccdbSNP:193922648
complement(171)-g, adbSNP:201209341
complement(177)-g, cdbSNP:200297370
complement(210)-g, adbSNP:11540224
complement(212)-g, cdbSNP:3180515
complement(217)-c, adbSNP:12853266
complement(336)-dbSNP:
complement(336)-t, adbSNP:12097
complement(383)-dbSNP:
complement(383)-t, cdbSNP:113529754
complement(519)-g, adbSNP:147369153
complement(565)-t, cdbSNP:149276836
complement(620)-dbSNP:
complement(620)-t, adbSNP:137852527
complement(633)-g, adbSNP:200348335
complement(643)-, adbSNP:193922649
complement(652)-t, cdbSNP:138374063
complement(684)-g, adbSNP:150520869
complement(697)-t, cdbSNP:141574558
complement(700)-t, cdbSNP:104894857
complement(766)-dbSNP:
complement(766)-t, adbSNP:138991195
complement(771)-t, cdbSNP:201030806
complement(810)-t, cdbSNP:112341751
complement(841)-t, cdbSNP:145169006
complement(935)-dbSNP:
complement(935)-c, adbSNP:141541387
complement(946)-g, adbSNP:185823878
complement(947)-c, adbSNP:1043878
complement(951)-g, adbSNP:138435481
complement(953)-g, adbSNP:111703410
complement(977)-t, cdbSNP:200934351
complement(1003)-t, cdbSNP:143699208
complement(1076)-dbSNP:
complement(1076)-g, adbSNP:201328350
complement(1107)-g, adbSNP:73219144
complement(1108)-g, adbSNP:104894858
complement(1141)-t, cdbSNP:104894859
complement(1145)-t, adbSNP:190221827
complement(1183)-g, cdbSNP:145703593
complement(1257)-g, adbSNP:1139708
complement(1271)-g, adbSNP:183781327
complement(1287)-dbSNP:
complement(1287)-t, cdbSNP:149783672
complement(1315)-t, cdbSNP:140936359
complement(1350)-g, adbSNP:147630563
complement(1351)-t, cdbSNP:144140265
complement(1665)-t, gdbSNP:191040541
complement(1828)-g, adbSNP:187001041
complement(1836)-c, adbSNP:45622238
complement(1836)-, c, cadbSNP:60325643
complement(1837)-c, adbSNP:113842465
complement(1838)-c, adbSNP:112371042
complement(1872..1873)-, acdbSNP:72241311
complement(1873..1874)-, ca, cacadbSNP:67522937
complement(1886)-g, adbSNP:12850824
complement(1887)-t, cdbSNP:12862637
complement(1935)-t, gdbSNP:190220547
complement(1997)-t, cdbSNP:186556741
complement(2102)-t, adbSNP:12852798
complement(2293)-g, adbSNP:149520898
complement(2430)-g, adbSNP:41310450
complement(2648)-g, adbSNP:188382921
complement(2673)-t, cdbSNP:183673904
complement(2726..2729)-, tttgdbSNP:199756350
complement(2868)-t, cdbSNP:5957387
complement(2881)-t, cdbSNP:42889
complement(3080)-t, cdbSNP:192936472
complement(3118)-t, adbSNP:5957386
complement(3141)-, a, aaadbSNP:71647314
complement(3148)-c, adbSNP:112195778
complement(3149)-c, adbSNP:113361775
complement(3153..3154)-, aadbSNP:201938539
complement(3154)-, a, aa, aaadbSNP:10565432
complement(3159)-c, adbSNP:12853078
complement(3185)-g, cdbSNP:112151652
complement(3250..3251)-, atdbSNP:113932840
complement(3262..3263)-, tadbSNP:143416156
complement(3263..3264)-, atdbSNP:66827020
complement(3330)-c, adbSNP:16995851
complement(3349)-t, cdbSNP:14410
complement(3364)-g, adbSNP:5957385
complement(3519)-c, adbSNP:184879874
complement(3708)-t, cdbSNP:192985244
complement(3835)-g, cdbSNP:187317957
complement(3848)-t, adbSNP:11540225
complement(3908)-t, gdbSNP:183386365
complement(3987)-t, adbSNP:1802861
complement(4069)-t, cdbSNP:142526834
Gene SymbolLAMP2
Gene SynonymCD107b; LAMP-2; LAMPB; LGP110
ChromosomeX
Locus MapXq24
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001122606 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant C, mRNA. Full Length $1318.45
ORF Sequence $358.44
NM_002294 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant A, mRNA. Full Length $2971.35
ORF Sequence $357.57
NM_013995 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA. Full Length $1426.60
ORF Sequence $357.57
Title Age-related decrease of the LAMP-2 gene expression in human leukocytes .
Author Huang,J., Xu,J., Pang,S., Bai,B. and Yan,B.
Journal Clin. Biochem. 45 (15), 1229-1232 (2012)
Title Genetic analysis of the LAMP-2 gene promoter in patients with sporadic Parkinson's disease .
Author Pang,S., Chen,D., Zhang,A., Qin,X. and Yan,B.
Journal Neurosci. Lett. 526 (1), 63-67 (2012)
Title The lysosomal polypeptide transporter TAPL is stabilized by interaction with LAMP-1 and LAMP-2 .
Author Demirel,O., Jan,I., Wolters,D., Blanz,J., Saftig,P., Tampe,R. and Abele,R.
Journal J. Cell. Sci. 125 (PT 18), 4230-4240 (2012)
Title Danon disease caused by two novel mutations of the LAMP2 gene: implications for two ends of the clinical spectrum .
Author Hong,D., Shi,Z., Wang,Z. and Yuan,Y.
Journal Clin. Neuropathol. 31 (4), 224-231 (2012)
Title The role of chaperone-mediated autophagy in huntingtin degradation .
Author Qi,L., Zhang,X.D., Wu,J.C., Lin,F., Wang,J., DiFiglia,M. and Qin,Z.H.
Journal PLoS ONE 7 (10), E46834 (2012)
Title Unifying nomenclature for the isoforms of the lysosomal membrane protein LAMP-2 .
Author Eskelinen,E.L., Cuervo,A.M., Taylor,M.R., Nishino,I., Blum,J.S., Dice,J.F., Sandoval,I.V., Lippincott-Schwartz,J., August,J.T. and Saftig,P.
Journal Traffic 6 (11), 1058-1061 (2005)
Title Isolation of dense granules from human platelets .
Author Fukami,M.H.
Journal Meth. Enzymol. 215, 36-42 (1992)
Title Confirmation of the chromosomal localization of human lamp genes and their exclusion as candidate genes for Salla disease .
Author Schleutker,J., Haataja,L., Renlund,M., Puhakka,L., Viitala,J., Peltonen,L. and Aula,P.
Journal Hum. Genet. 88 (1), 95-97 (1991)
Title The nucleotide sequence of a CpG island demonstrates the presence of the first exon of the gene encoding the human lysosomal membrane protein lamp2 and assigns the gene to Xq24 .
Author Manoni,M., Tribioli,C., Lazzari,B., DeBellis,G., Patrosso,C., Pergolizzi,R., Pellegrini,M., Maestrini,E., Rivella,S., Vezzoni,P. et al.
Journal Genomics 9 (3), 551-554 (1991)
Title The polylactosaminoglycans of human lysosomal membrane glycoproteins lamp-1 and lamp-2. Localization on the peptide backbones .
Author Carlsson,S.R. and Fukuda,M.
Journal J. Biol. Chem. 265 (33), 20488-20495 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878