• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23847 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu23847C Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_013995.2, 169790831
Length 1233 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA.
Product lysosome-associated membrane glycoprotein 2 isoform B precursor
Comment

Summary: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (B) results from alternative splicing of exon 9 and results in a shorter transcript, but not protein, as compared to variant A. Transcript variant B is over-expressed in muscle and encodes isoform B.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_054701.1
CDS 181..1413
Misc Feature(1)37..39
Misc Feature(2)37..39
Misc Feature(3)274..276
Misc Feature(4)292..294
Misc Feature(5)325..327
Misc Feature(6)352..354
Misc Feature(7)505..1410
Misc Feature(8)763..765
Misc Feature(9)766..768
Misc Feature(10)778..780
Misc Feature(11)787..789
Misc Feature(12)790..792
Misc Feature(13)799..801
Misc Feature(14)805..807
Misc Feature(15)808..810
Misc Feature(16)811..813
Misc Feature(17)904..906
Misc Feature(18)1099..1101
Exon (1)1..244
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (2)245..363
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (3)364..577
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (4)578..736
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (5)737..921
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (6)922..1044
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (7)1045..1108
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (8)1109..1273
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Exon (9)1274..4073
Gene:LAMP2
Gene Synonym:CD107b; LAMP-2; LAMPB; LGP110
Translation MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKT YKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNT GDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNG TVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQ LNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN ISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQG KYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVIAYVIGRRKSYAGYQTL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(43)-c, adbSNP:144321444
complement(46)-t, cdbSNP:181118176
complement(81)-t, cdbSNP:188688129
complement(96)-t, gdbSNP:370136094
complement(148)-g, adbSNP:368403767
158..166+, gtcgccgccdbSNP:193922648
complement(171)-g, adbSNP:201209341
complement(177)-t, g, cdbSNP:200297370
210+a, gdbSNP:11540224
212+c, gdbSNP:3180515
complement(214)-t, adbSNP:367914423
complement(217)-c, adbSNP:12853266
236+g, tdbSNP:397516745
complement(274)-dbSNP:
complement(274)-t, cdbSNP:367625418
336+a, tdbSNP:12097
338+a, gdbSNP:397516735
363+a, g, tdbSNP:397516736
371+dbSNP:
371+, tdbSNP:397516738
complement(383)-t, cdbSNP:113529754
complement(384)-g, cdbSNP:376215728
397..398+, adbSNP:397516739
complement(433)-t, cdbSNP:371149731
473+a, gdbSNP:397516740
479+c, tdbSNP:397516741
513+c, tdbSNP:397516742
complement(519)-g, adbSNP:147369153
complement(520)-t, cdbSNP:377652722
551+c, tdbSNP:397516744
complement(565)-t, cdbSNP:149276836
complement(595)-dbSNP:
complement(595)-t, cdbSNP:373007615
620+a, tdbSNP:137852527
complement(633)-g, adbSNP:200348335
643+, adbSNP:193922649
complement(652)-t, cdbSNP:138374063
complement(684)-g, adbSNP:150520869
complement(695)-g, adbSNP:371174243
complement(697)-t, cdbSNP:141574558
700+c, tdbSNP:104894857
759..766+dbSNP:
759..766+, aacttcaadbSNP:398123685
complement(766)-t, adbSNP:138991195
complement(771)-t, cdbSNP:201030806
complement(810)-t, cdbSNP:112341751
complement(841)-t, cdbSNP:145169006
852+a, gdbSNP:397516746
complement(935)-dbSNP:
complement(935)-c, adbSNP:141541387
complement(946)-g, adbSNP:185823878
947+a, cdbSNP:1043878
complement(949)-t, cdbSNP:369032377
complement(951)-g, adbSNP:138435481
complement(953)-g, adbSNP:111703410
complement(977)-t, cdbSNP:200934351
complement(1003)-t, cdbSNP:143699208
1004+a, gdbSNP:397516747
1022+a, gdbSNP:397516748
1025+g, tdbSNP:397516749
complement(1030)-g, adbSNP:374690629
1035+c, tdbSNP:397516750
complement(1076)-dbSNP:
complement(1076)-g, adbSNP:201328350
complement(1107)-g, adbSNP:73219144
1108+a, gdbSNP:104894858
complement(1140)-g, adbSNP:371959861
1141+c, tdbSNP:104894859
complement(1145)-t, adbSNP:190221827
complement(1183)-g, cdbSNP:145703593
1257+a, gdbSNP:1139708
complement(1264)-g, adbSNP:367740222
complement(1271)-g, adbSNP:183781327
complement(1287)-dbSNP:
complement(1287)-t, cdbSNP:149783672
complement(1315)-t, cdbSNP:140936359
complement(1350)-g, adbSNP:147630563
complement(1351)-t, cdbSNP:144140265
complement(1368)-g, adbSNP:375487167
complement(1405)-t, adbSNP:370910743
complement(1426)-g, adbSNP:377303143
complement(1665)-t, gdbSNP:191040541
complement(1828)-g, adbSNP:187001041
complement(1836)-, cdbSNP:60325643
complement(1836)-c, adbSNP:45622238
complement(1837)-c, adbSNP:113842465
complement(1838)-c, adbSNP:112371042
complement(1873..1874)-, cadbSNP:67522937
complement(1886)-g, adbSNP:12850824
complement(1887)-t, cdbSNP:12862637
complement(1935)-t, gdbSNP:190220547
complement(1997)-t, cdbSNP:186556741
complement(2102)-t, adbSNP:12852798
2293+a, gdbSNP:149520898
complement(2430)-g, adbSNP:41310450
complement(2648)-g, adbSNP:188382921
complement(2673)-t, cdbSNP:183673904
complement(2694..2703)-, ttttgttttgdbSNP:375999498
complement(2711..2714)-, gtttdbSNP:375197709
complement(2726..2729)-, tttgdbSNP:199756350
complement(2868)-t, cdbSNP:5957387
complement(2881)-t, cdbSNP:42889
complement(2881)-t, cdbSNP:386456195
complement(3080)-t, cdbSNP:192936472
complement(3089)-g, adbSNP:375062333
complement(3118)-t, adbSNP:5957386
complement(3119)-g, adbSNP:371130964
complement(3148)-c, adbSNP:112195778
complement(3149)-c, adbSNP:113361775
complement(3153..3154)-, aadbSNP:201938539
complement(3154)-, adbSNP:10565432
complement(3159)-c, adbSNP:12853078
complement(3185)-g, cdbSNP:112151652
complement(3250..3251)-, atdbSNP:113932840
complement(3260..3261)-, tadbSNP:143416156
complement(3263..3264)-, atdbSNP:371366876
complement(3330)-c, adbSNP:16995851
3349+c, tdbSNP:14410
complement(3364)-g, adbSNP:5957385
complement(3519)-c, adbSNP:184879874
complement(3708)-t, cdbSNP:192985244
complement(3835)-g, cdbSNP:187317957
complement(3848)-t, adbSNP:11540225
complement(3908)-t, gdbSNP:183386365
3987+a, tdbSNP:1802861
complement(4069)-t, cdbSNP:142526834
Gene SymbolLAMP2
Gene SynonymCD107b; LAMP-2; LAMPB; LGP110
ChromosomeX
Locus MapXq24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_013995 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA. On-demand $219.00 7-9
NM_013995 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA. On-demand $219.00 7-9
NM_013995 Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, mRNA. On-demand $219.00 7-9
Title Autoantibodies to hLAMP-2 in ANCA-negative pauci-immune focal necrotizing GN .
Author Peschel A, Basu N, Benharkou A, Brandes R, Brown M, Dieckmann R, Rees AJ and Kain R.
Journal J. Am. Soc. Nephrol. 25 (3), 455-463 (2014)
Title Lysosome-associated protein 1 (LAMP-1) and lysosome-associated protein 2 (LAMP-2) in a larger family carrier of Fabry disease .
Author Pereira EM, do Monte SJ, do Nascimento FF, de Castro JA, Sousa JL, Filho HC, da Silva RN, Labilloy A, Monte Neto JT and da Silva AS.
Journal Gene 536 (1), 118-122 (2014)
Title Lysosomal-associated membrane protein-2 plays an important role in the pathogenesis of primary cutaneous vasculitis .
Author Takeuchi S, Kimura S, Soma Y, Waki M, Yamaguchi M, Nakazawa D, Tomaru U, Ishizu A and Kawakami T.
Journal Rheumatology (Oxford) 52 (9), 1592-1598 (2013)
Title Stimulation of CD107 affects LPS-induced cytokine secretion and cellular adhesion through the ERK signaling pathway in the human macrophage-like cell line, THP-1 .
Author Min BK, Suk K and Lee WH.
Journal Cell. Immunol. 281 (2), 122-128 (2013)
Title Influence of microRNA deregulation on chaperone-mediated autophagy and alpha-synuclein pathology in Parkinson's disease .
Author Alvarez-Erviti L, Seow Y, Schapira AH, Rodriguez-Oroz MC, Obeso JA and Cooper JM.
Journal Cell Death Dis 4, E545 (2013)
Title Unifying nomenclature for the isoforms of the lysosomal membrane protein LAMP-2 .
Author Eskelinen EL, Cuervo AM, Taylor MR, Nishino I, Blum JS, Dice JF, Sandoval IV, Lippincott-Schwartz J, August JT and Saftig P.
Journal Traffic 6 (11), 1058-1061 (2005)
Title Isolation of dense granules from human platelets .
Author Fukami MH.
Journal Meth. Enzymol. 215, 36-42 (1992)
Title Confirmation of the chromosomal localization of human lamp genes and their exclusion as candidate genes for Salla disease .
Author Schleutker J, Haataja L, Renlund M, Puhakka L, Viitala J, Peltonen
Journal Hum. Genet. 88 (1), 95-97 (1991)
Title The nucleotide sequence of a CpG island demonstrates the presence of the first exon of the gene encoding the human lysosomal membrane protein lamp2 and assigns the gene to Xq24 .
Author Manoni M, Tribioli C, Lazzari B, DeBellis G, Patrosso C, Pergolizzi R, Pellegrini M, Maestrini E, Rivella S and Vezzoni P.
Journal Genomics 9 (3), 551-554 (1991)
Title The polylactosaminoglycans of human lysosomal membrane glycoproteins lamp-1 and lamp-2. Localization on the peptide backbones .
Author Carlsson SR and Fukuda M.
Journal J. Biol. Chem. 265 (33), 20488-20495 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.