• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens vinculin (VCL), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_014000 Homo sapiens vinculin (VCL), transcript variant 1, mRNA. ORF Sequence $1191.75
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_014000.2, 50593530
Length 5647 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens vinculin (VCL), transcript variant 1, mRNA.
Product vinculin isoform meta-VCL
Comment

Summary: Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) differs from variant 2 in having an additional exon in the 3' coding region. It thus encodes a longer isoform (meta-VCL).

RefSeq NP_054706.1
CDS 95..3499
Misc Feature(1)2..4
Misc Feature(2)2..4
Misc Feature(3)98..2599
Misc Feature(4)98..2599
Misc Feature(5)101..>1174
Misc Feature(6)347..349
Misc Feature(7)392..394
Misc Feature(8)596..718
Misc Feature(9)611..613
Misc Feature(10)869..1861
Misc Feature(11)956..958
Misc Feature(12)956..958
Misc Feature(13)962..964
Misc Feature(14)962..964
Misc Feature(15)1130..1132
Misc Feature(16)<1217..2839
Misc Feature(17)1394..1396
Misc Feature(18)1580..1582
Misc Feature(19)1904..1906
Misc Feature(20)2168..2170
Misc Feature(21)2255..2257
Misc Feature(22)2255..2257
Misc Feature(23)2558..2560
Misc Feature(24)2558..2560
Misc Feature(25)2600..2728
Misc Feature(26)2729..3496
Misc Feature(27)3101..3232
Misc Feature(28)3395..3397
Misc Feature(29)3431..3433
Misc Feature(30)3452..3496
Misc Feature(31)3491..3493
Misc Feature(32)3491..3493
Exon (1)1..262
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (2)263..333
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (3)334..484
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (4)485..593
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (5)594..716
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (6)717..877
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (7)878..968
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (8)969..1116
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (9)1117..1270
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (10)1271..1446
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (11)1447..1637
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (12)1638..1837
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (13)1838..1966
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (14)1967..2116
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (15)2117..2225
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (16)2226..2528
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (17)2529..2653
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (18)2654..2839
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (19)2840..3043
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (20)3044..3247
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (21)3248..3352
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Exon (22)3353..5490
Gene:VCL
Gene Synonym:CMD1W; CMH15; MVCL
Translation MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQ PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAK DIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
100+a, cdbSNP:143520539
124+a, gdbSNP:146750460
175+c, tdbSNP:200733607
197+a, gdbSNP:139329923
214+c, tdbSNP:144080529
278+dbSNP:
278+a, gdbSNP:147809878
349+dbSNP:
349+c, tdbSNP:117384664
394+c, tdbSNP:71535779
433+a, gdbSNP:56314318
460+a, gdbSNP:199562976
472+c, tdbSNP:148966602
586+dbSNP:
586+g, tdbSNP:143702799
659+dbSNP:
659+g, tdbSNP:151045204
684+c, tdbSNP:189242810
685+c, tdbSNP:199960157
719+dbSNP:
719+a, tdbSNP:144683137
754+c, tdbSNP:56264452
770+a, gdbSNP:146910007
782+c, tdbSNP:139312390
789+a, tdbSNP:200956572
794+c, gdbSNP:17853882
805+a, gdbSNP:61731175
862+c, tdbSNP:56413529
881+dbSNP:
881+a, tdbSNP:142233726
882+c, gdbSNP:150443513
923+a, cdbSNP:71579353
957+c, gdbSNP:138270989
1039+dbSNP:
1039+a, cdbSNP:61731180
1041+a, cdbSNP:143944164
1059..1060+, gdbSNP:35755339
1134+dbSNP:
1134+c, tdbSNP:148619523
1160+a, gdbSNP:141503166
1251+a, gdbSNP:200342284
1264+c, tdbSNP:201459260
1286+dbSNP:
1286+c, tdbSNP:201528612
1292+g, tdbSNP:201361282
1319+c, tdbSNP:202005455
1331+a, gdbSNP:146278697
1347+c, tdbSNP:147566238
1381+a, tdbSNP:139371702
1388+c, gdbSNP:144146254
1390+a, gdbSNP:150993814
1391+c, tdbSNP:139559937
1406+a, gdbSNP:150016624
1411+c, tdbSNP:71579355
1423+c, tdbSNP:142350240
1442+a, cdbSNP:142128712
1484+dbSNP:
1484+a, gdbSNP:200710859
1497+c, tdbSNP:147957747
1501+c, tdbSNP:2229507
1599+a, gdbSNP:201808867
1600+a, gdbSNP:2228373
1636+c, tdbSNP:7904077
1649+dbSNP:
1649+a, cdbSNP:141033098
1651+a, cdbSNP:150120464
1666+c, tdbSNP:138566234
1672+a, gdbSNP:141544441
1701+a, cdbSNP:200624351
1720+c, tdbSNP:150402791
1765+c, tdbSNP:137877092
1810+g, tdbSNP:189781480
1859+dbSNP:
1859+a, gdbSNP:187247459
1882+a, cdbSNP:199582103
1934+a, tdbSNP:142695754
1936+a, gdbSNP:144117013
1938+c, tdbSNP:148669762
2001+dbSNP:
2001+a, gdbSNP:71579374
2022+c, tdbSNP:150643310
2041+a, gdbSNP:200168992
2119+dbSNP:
2119+a, gdbSNP:140766884
2276+dbSNP:
2276+a, gdbSNP:144717954
2359+c, tdbSNP:147887754
2416+c, tdbSNP:202184524
2482+a, gdbSNP:767809
2489+a, gdbSNP:150069336
2521+c, tdbSNP:183739128
2566+dbSNP:
2566+c, gdbSNP:140381835
2615+c, gdbSNP:150385900
2625+c, tdbSNP:145393322
2749+dbSNP:
2749+c, tdbSNP:149196315
2841+dbSNP:
2841+c, tdbSNP:143321584
2854+c, tdbSNP:138594604
2890+c, tdbSNP:140308982
2893+a, gdbSNP:199507346
2895+c, tdbSNP:16931179
2908+c, gdbSNP:2131956
2921+c, gdbSNP:71579375
2923+c, tdbSNP:200480221
2999+a, gdbSNP:199751261
3017+c, tdbSNP:121917776
3063+c, tdbSNP:150595117
3160+c, tdbSNP:138619320
3254+dbSNP:
3254+a, gdbSNP:182756080
3274+c, tdbSNP:149602433
3310+c, tdbSNP:201015523
3331+c, tdbSNP:201526599
3361+dbSNP:
3361+c, gdbSNP:149300310
3427+c, tdbSNP:147415627
3469+a, cdbSNP:12573090
3606+a, tdbSNP:76086805
3618+c, tdbSNP:181553856
3721+a, gdbSNP:187329763
3748+c, tdbSNP:143302346
3791+c, gdbSNP:77295081
3798+a, cdbSNP:79597107
3852..3853+, ctdbSNP:144115212
3887+a, cdbSNP:1804892
4057+a, gdbSNP:192181239
4145+c, gdbSNP:41280414
4151+c, tdbSNP:79816413
4197+a, cdbSNP:182637339
4227+a, cdbSNP:187721829
4326..4327+, cdbSNP:71021590
4486+c, tdbSNP:145634601
4487..4488+, tadbSNP:16408
4487+a, cdbSNP:78391049
4488..4489+, tadbSNP:72109294
4489..4490+, atdbSNP:66475604
4490..4491+, atdbSNP:10691440
4491+a, cdbSNP:199954386
4493+a, gdbSNP:200520943
4536+a, tdbSNP:1049456
4540..4541+, cdbSNP:36124091
4702+a, cdbSNP:149551128
4826..4827+, tattdbSNP:149589487
4842..4843+, agtadbSNP:112557979
4842+c, tdbSNP:71535723
5083+a, tdbSNP:703258
5135+c, tdbSNP:144240368
5158+c, tdbSNP:1804893
5202..5203+, aaagadbSNP:140046305
5230+a, gdbSNP:1801382
5311..5312+, atcdbSNP:151279619
5315..5316+, tcadbSNP:35726593
5322+a, gdbSNP:8255
5342..5343+, aadbSNP:3037361
5342+, adbSNP:59061551
5348..5349+a, cdbSNP:1049613
5348..5349+, cdbSNP:200756813
5348+g, tdbSNP:3829205
5350..5351+a, cdbSNP:3189804
5353..5354+, cdbSNP:201189785
5353+g, tdbSNP:3829204
5387+a, cdbSNP:1049614
Gene SymbolVCL
Gene SynonymCMD1W; CMH15; MVCL
Chromosome10
Locus Map10q22.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_003373 Homo sapiens vinculin (VCL), transcript variant 2, mRNA. Full Length $2449.35
ORF Sequence $1120.35
NM_014000 Homo sapiens vinculin (VCL), transcript variant 1, mRNA. Full Length $2541.15
ORF Sequence $1191.75
Title Proteomic differential display identifies upregulated vinculin as a possible biomarker of pancreatic cancer .
Author Wang,Y., Kuramitsu,Y., Ueno,T., Suzuki,N., Yoshino,S., Iizuka,N., Zhang,X., Akada,J., Oka,M. and Nakamura,K.
Journal Oncol. Rep. 28 (5), 1845-1850 (2012)
Title The metavinculin tail domain directs constitutive interactions with raver1 and vinculin RNA .
Author Lee,J.H., Rangarajan,E.S., Vonrhein,C., Bricogne,G. and Izard,T.
Journal J. Mol. Biol. 422 (5), 697-704 (2012)
Title The C-terminal tail domain of metavinculin, vinculin's splice variant, severs actin filaments .
Author Janssen,M.E., Liu,H., Volkmann,N. and Hanein,D.
Journal J. Cell Biol. 197 (5), 585-593 (2012)
Title The cytoskeletal protein alpha-catenin unfurls upon binding to vinculin .
Author Rangarajan,E.S. and Izard,T.
Journal J. Biol. Chem. 287 (22), 18492-18499 (2012)
Title Vinculin associates with endothelial VE-cadherin junctions to control force-dependent remodeling .
Author Huveneers,S., Oldenburg,J., Spanjaard,E., van der Krogt,G., Grigoriev,I., Akhmanova,A., Rehmann,H. and de Rooij,J.
Journal J. Cell Biol. 196 (5), 641-652 (2012)
Title Complementary physical and genetic techniques map the vinculin (VCL) gene on chromosome 10q .
Author Mulligan,L.M., Gardner,E., Telenius,H. and Ponder,B.A.
Journal Genomics 13 (4), 1347-1349 (1992)
Title An additional exon in the human vinculin gene specifically encodes meta-vinculin-specific difference peptide. Cross-species comparison reveals variable and conserved motifs in the meta-vinculin insert .
Author Koteliansky,V.E., Ogryzko,E.P., Zhidkova,N.I., Weller,P.A., Critchley,D.R., Vancompernolle,K., Vandekerckhove,J., Strasser,P., Way,M., Gimona,M. et al.
Journal Eur. J. Biochem. 204 (2), 767-772 (1992)
Title Complete sequence of human vinculin and assignment of the gene to chromosome 10 .
Author Weller,P.A., Ogryzko,E.P., Corben,E.B., Zhidkova,N.I., Patel,B., Price,G.J., Spurr,N.K., Koteliansky,V.E. and Critchley,D.R.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (15), 5667-5671 (1990)
Title Detection of metavinculin in human platelets using a modified talin overlay assay .
Author Turner,C.E. and Burridge,K.
Journal Eur. J. Cell Biol. 49 (1), 202-206 (1989)
Title Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa .
Author Gogstad,G.O., Hagen,I., Korsmo,R. and Solum,N.O.
Journal Biochim. Biophys. Acta 670 (2), 150-162 (1981)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878