• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens vinculin (VCL), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25616 Homo sapiens vinculin (VCL), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu25616C Homo sapiens vinculin (VCL), transcript variant 1, mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_014000.2, 50593530
Length 3405 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens vinculin (VCL), transcript variant 1, mRNA.
Product vinculin isoform meta-VCL
Comment

Summary: Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) differs from variant 2 in having an additional exon in the 3' coding region. It thus encodes a longer isoform (meta-VCL).

RefSeq NP_054706.1
CDS 95..3499
Misc Feature(1)2..4
Misc Feature(2)2..4
Misc Feature(3)98..2599
Misc Feature(4)98..2599
Misc Feature(5)101..3496
Misc Feature(6)347..349
Misc Feature(7)392..394
Misc Feature(8)596..718
Misc Feature(9)611..613
Misc Feature(10)869..1861
Misc Feature(11)956..958
Misc Feature(12)956..958
Misc Feature(13)962..964
Misc Feature(14)962..964
Misc Feature(15)1130..1132
Misc Feature(16)1394..1396
Misc Feature(17)1580..1582
Misc Feature(18)1904..1906
Misc Feature(19)2168..2170
Misc Feature(20)2255..2257
Misc Feature(21)2255..2257
Misc Feature(22)2558..2560
Misc Feature(23)2558..2560
Misc Feature(24)2600..2728
Misc Feature(25)2729..3496
Misc Feature(26)3101..3232
Misc Feature(27)3395..3397
Misc Feature(28)3431..3433
Misc Feature(29)3452..3496
Misc Feature(30)3491..3493
Misc Feature(31)3491..3493
Exon (1)1..262
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (2)263..333
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (3)334..484
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (4)485..593
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (5)594..716
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (6)717..877
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (7)878..968
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (8)969..1116
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (9)1117..1270
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (10)1271..1446
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (11)1447..1637
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (12)1638..1837
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (13)1838..1966
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (14)1967..2116
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (15)2117..2225
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (16)2226..2528
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (17)2529..2653
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (18)2654..2839
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (19)2840..3043
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (20)3044..3247
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (21)3248..3352
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Exon (22)3353..5490
Gene:VCL
Gene Synonym:CMD1W; CMH15; HEL114; MV; MVCL
Translation MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQ PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAK DIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
35+c, tdbSNP:370879754
62+c, gdbSNP:368934359
124+a, gdbSNP:146750460
125+a, gdbSNP:397517240
175+c, tdbSNP:200733607
197+a, gdbSNP:139329923
214+c, tdbSNP:144080529
278+dbSNP:
278+a, gdbSNP:147809878
318+c, tdbSNP:373830664
349+dbSNP:
349+c, tdbSNP:117384664
394+c, tdbSNP:71535779
407+c, tdbSNP:397517239
433+a, gdbSNP:56314318
433+a, gdbSNP:386454293
460+a, gdbSNP:199562976
472+c, tdbSNP:148966602
498+dbSNP:
498+c, tdbSNP:373744314
551+a, cdbSNP:376921881
566+g, tdbSNP:371583362
576+c, tdbSNP:376226543
586+g, tdbSNP:143702799
656+dbSNP:
656+c, tdbSNP:397517244
659+c, g, tdbSNP:151045204
665+c, tdbSNP:370334093
684+c, tdbSNP:189242810
685+c, tdbSNP:199960157
719+dbSNP:
719+a, tdbSNP:144683137
753..754+, adbSNP:397517245
754+c, tdbSNP:56264452
770+a, gdbSNP:146910007
782+c, tdbSNP:139312390
789+a, tdbSNP:200956572
794+c, gdbSNP:17853882
805+a, gdbSNP:61731175
862+c, tdbSNP:56413529
881+dbSNP:
881+a, tdbSNP:142233726
882+c, gdbSNP:150443513
923+a, cdbSNP:71579353
948+a, gdbSNP:397517246
957+c, gdbSNP:138270989
1039+dbSNP:
1039+a, cdbSNP:61731180
1041+a, cdbSNP:143944164
1046+c, tdbSNP:397517247
1059..1060+, gdbSNP:35755339
1112+a, gdbSNP:372655194
1113+c, tdbSNP:374928228
1134+dbSNP:
1134+c, tdbSNP:148619523
1135+c, gdbSNP:373079313
1160+a, gdbSNP:141503166
1209+a, gdbSNP:377289804
1251+a, gdbSNP:200342284
1258+c, tdbSNP:370852950
1261+c, tdbSNP:377730275
1264+c, tdbSNP:201459260
1286+dbSNP:
1286+c, tdbSNP:201528612
1289+a, cdbSNP:377228795
1292+g, tdbSNP:201361282
1319+c, tdbSNP:202005455
1331+a, gdbSNP:146278697
1347+c, tdbSNP:147566238
1369+c, tdbSNP:397517233
1381+a, tdbSNP:139371702
1388+c, gdbSNP:144146254
1390+a, gdbSNP:150993814
1391+c, tdbSNP:139559937
1406+a, gdbSNP:150016624
1411+c, tdbSNP:71579355
1423+c, tdbSNP:142350240
1442+a, cdbSNP:142128712
1484+dbSNP:
1484+a, c, gdbSNP:200710859
1497+c, tdbSNP:147957747
1501+c, tdbSNP:2229507
1529+c, tdbSNP:369055603
1599+a, gdbSNP:201808867
1600+a, gdbSNP:2228373
1629+a, gdbSNP:367568441
1636+c, tdbSNP:7904077
1649+dbSNP:
1649+a, cdbSNP:141033098
1651+a, cdbSNP:150120464
1652+c, tdbSNP:377722209
1666+c, tdbSNP:138566234
1672+a, gdbSNP:141544441
1700+a, cdbSNP:370058111
1701+a, cdbSNP:200624351
1715+c, gdbSNP:370229150
1720+c, tdbSNP:150402791
1733+c, tdbSNP:397517234
1765+c, tdbSNP:137877092
1784+g, tdbSNP:374538684
1791+g, tdbSNP:376620290
1810+g, tdbSNP:189781480
1859+dbSNP:
1859+a, gdbSNP:187247459
1882+a, cdbSNP:199582103
1886+a, gdbSNP:397517235
1892+a, cdbSNP:397517236
1934+a, tdbSNP:142695754
1936+a, gdbSNP:144117013
1938+c, tdbSNP:148669762
1955+a, gdbSNP:374309823
1960+a, gdbSNP:372402817
2001+dbSNP:
2001+a, gdbSNP:71579374
2002+c, tdbSNP:372696553
2022+c, tdbSNP:150643310
2041+a, gdbSNP:200168992
2067+c, tdbSNP:372691803
2119+dbSNP:
2119+a, gdbSNP:140766884
2129+g, tdbSNP:375392559
2231+dbSNP:
2231+a, gdbSNP:374737519
2236+c, tdbSNP:373790383
2276+a, gdbSNP:144717954
2323+c, gdbSNP:376448550
2359+c, tdbSNP:147887754
2367+c, gdbSNP:371970354
2416+c, tdbSNP:202184524
2482+a, gdbSNP:767809
2489+a, gdbSNP:150069336
2521+c, tdbSNP:183739128
2538+dbSNP:
2538+a, gdbSNP:373010557
2566+c, gdbSNP:140381835
2615+c, gdbSNP:150385900
2625+c, tdbSNP:145393322
2633+c, tdbSNP:372711612
2746+dbSNP:
2746+a, gdbSNP:371187988
2749+c, tdbSNP:149196315
2822+c, gdbSNP:375595550
2841+dbSNP:
2841+c, tdbSNP:143321584
2854+c, tdbSNP:138594604
2856+c, tdbSNP:375254227
2880+c, tdbSNP:368113653
2890+c, tdbSNP:140308982
2893+a, gdbSNP:199507346
2895+c, tdbSNP:16931179
2896+c, tdbSNP:372381809
complement(2908)-g, cdbSNP:2131956
2919+a, cdbSNP:375627694
2921+c, gdbSNP:71579375
2923+c, tdbSNP:200480221
2946+c, gdbSNP:368570586
2949+a, tdbSNP:367805257
2956..2958+, gttdbSNP:397517237
2999+a, gdbSNP:199751261
3017+c, tdbSNP:121917776
3063+c, tdbSNP:150595117
3160+c, tdbSNP:138619320
3186+a, gdbSNP:397517238
3196+a, gdbSNP:373584575
3254+dbSNP:
3254+a, gdbSNP:182756080
3274+c, tdbSNP:149602433
3310+c, tdbSNP:201015523
3320+c, tdbSNP:397517241
3331+c, tdbSNP:201526599
3361+dbSNP:
3361+c, gdbSNP:149300310
3421+c, tdbSNP:397517242
3427+c, tdbSNP:147415627
3467+c, tdbSNP:373317423
3469+a, cdbSNP:12573090
3606+a, tdbSNP:76086805
3618+c, tdbSNP:181553856
3721+a, gdbSNP:187329763
3748+c, tdbSNP:143302346
3791+c, gdbSNP:77295081
3798+a, cdbSNP:79597107
3852..3853+, ctdbSNP:144115212
3887+a, cdbSNP:1804892
4057+a, gdbSNP:192181239
4105+c, tdbSNP:368948216
4145+c, gdbSNP:41280414
4151+c, tdbSNP:79816413
4197+a, cdbSNP:182637339
4227+a, cdbSNP:187721829
complement(4328..4329)-, cdbSNP:71021590
4486+c, tdbSNP:145634601
4487..4488+, tadbSNP:16408
4487+a, cdbSNP:78391049
4488..4489+, at, tadbSNP:10691440
4489..4490+, atdbSNP:377692178
4490..4491+, atdbSNP:397804906
4491+a, cdbSNP:199954386
4493+a, gdbSNP:200520943
4536+a, tdbSNP:1049456
4540..4541+, cdbSNP:36124091
complement(4702)-c, adbSNP:149551128
4826..4827+, tattdbSNP:149589487
4842..4843+, agtadbSNP:112557979
4842+c, tdbSNP:71535723
complement(5083)-t, adbSNP:703258
5135+c, tdbSNP:144240368
5158+c, tdbSNP:1804893
5202..5203+, aaagadbSNP:140046305
5209..5210+, agaaadbSNP:377566645
5230+a, gdbSNP:1801382
5250+c, tdbSNP:372750308
5311..5312+, atcdbSNP:151279619
5315..5316+, tcadbSNP:35726593
5322+a, gdbSNP:8255
5341..5342+, aadbSNP:370456912
5342..5343+, aadbSNP:386371830
5346..5347+a, cdbSNP:1049613
5348..5349+, cdbSNP:200756813
complement(5348)-t, gdbSNP:3829205
5349..5350+a, cdbSNP:3189804
5349..5350+, cdbSNP:377181096
5353..5354+, cdbSNP:201189785
complement(5353)-t, gdbSNP:3829204
5361..5362+, aadbSNP:3037361
5361+, adbSNP:59061551
5387+a, cdbSNP:1049614
Gene SymbolVCL
Gene SynonymCMD1W; CMH15; HEL114; MV; MVCL
Chromosome10
Locus Map10q22.2
Title Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions .
Author Hirata H, Tatsumi H, Lim CT and Sokabe M.
Journal Am. J. Physiol., Cell Physiol. 306 (6), C607-C620 (2014)
Title Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances .
Author Fatemifar G, Hoggart CJ, Paternoster L, Kemp JP, Prokopenko I, Horikoshi M, Wright VJ, Tobias JH, Richmond S, Zhurov AI, Toma AM, Pouta A, Taanila A, Sipila K, Lahdesmaki R, Pillas D, Geller F, Feenstra B, Melbye M, Nohr EA, Ring SM, St Pourcain B, Timpson NJ, Davey Smith G, Jarvelin MR and Evans DM.
Journal Hum. Mol. Genet. 22 (18), 3807-3817 (2013)
Title Vinculin tension distributions of individual stress fibers within cell-matrix adhesions .
Author Chang CW and Kumar S.
Journal J. Cell. Sci. 126 (PT 14), 3021-3030 (2013)
Title Association of Nox1 and vinculin with colon cancer progression .
Author Sun Z and Liu F.
Journal Cancer Invest. 31 (4), 273-278 (2013)
Title Polymorphisms in FGF12, VCL, CX43 and VAX1 in Brazilian patients with nonsyndromic cleft lip with or without cleft palate .
Author de Aquino SN, Messetti AC, Bagordakis E, Martelli-Junior H, Swerts MS, Graner E and Coletta RD.
Journal BMC Med. Genet. 14, 53 (2013)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Complementary physical and genetic techniques map the vinculin (VCL) gene on chromosome 10q .
Author Mulligan LM, Gardner E, Telenius H and Ponder BA.
Journal Genomics 13 (4), 1347-1349 (1992)
Title An additional exon in the human vinculin gene specifically encodes meta-vinculin-specific difference peptide. Cross-species comparison reveals variable and conserved motifs in the meta-vinculin insert .
Author Koteliansky VE, Ogryzko EP, Zhidkova NI, Weller PA, Critchley DR, Vancompernolle K, Vandekerckhove J, Strasser P, Way M and Gimona M.
Journal Eur. J. Biochem. 204 (2), 767-772 (1992)
Title Complete sequence of human vinculin and assignment of the gene to chromosome 10 .
Author Weller PA, Ogryzko EP, Corben EB, Zhidkova NI, Patel B, Price GJ, Spurr NK, Koteliansky VE and Critchley DR.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (15), 5667-5671 (1990)
Title Detection of metavinculin in human platelets using a modified talin overlay assay .
Author Turner CE and Burridge K.
Journal Eur. J. Cell Biol. 49 (1), 202-206 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.