• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014225 Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_014225.5, 294774554
Length 2519 bp
Structure linear
Update Date 03-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA.
Product serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
Comment

Summary: This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described. [provided by RefSeq, Apr 2010].


Transcript Variant: This variant (1) represents the longer transcript and encodes the functional protein.

RefSeq NP_055040.2
CDS 296..2065
Misc Feature(1)272..274
Misc Feature(2)299..301
Misc Feature(3)299..301
Misc Feature(4)317..1492
Misc Feature(5)434..1258
Misc Feature(6)548..1012
Misc Feature(7)830..988
Misc Feature(8)854..>1681
Misc Feature(9)1133..1135
Misc Feature(10)<1481..>1657
Misc Feature(11)1493..2062
Misc Feature(12)1757..2044
Exon (1)1..373
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (2)374..464
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (3)465..565
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (4)566..798
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (5)799..946
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (6)947..1102
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (7)1103..1217
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (8)1218..1288
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (9)1289..1423
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (10)1424..1597
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (11)1598..1658
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (12)1659..1813
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (13)1814..1956
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (14)1957..2048
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (15)2049..2509
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Translation MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
23+dbSNP:
23+c, gdbSNP:112009029
102+a, gdbSNP:374414470
106+a, gdbSNP:184163465
126..127+, adbSNP:34945683
150+c, gdbSNP:112621280
223+c, tdbSNP:13344984
236..237+, cdbSNP:67495004
239..240+, tcdbSNP:112482978
240..241+, adbSNP:200079168
243..244+, tdbSNP:201332370
243+c, g, tdbSNP:111861947
244+a, cgdbSNP:3833207
244+a, g, tdbSNP:17554825
245+a, cdbSNP:62109200
246+a, gdbSNP:200899936
276+a, gdbSNP:199921290
307+c, tdbSNP:140334526
334+c, tdbSNP:201882921
343..344+c, tdbSNP:11537694
487+dbSNP:
487+g, tdbSNP:11537696
526+c, tdbSNP:371261424
554+c, tdbSNP:144146832
579+dbSNP:
579+c, tdbSNP:148604195
580+a, gdbSNP:142069409
632+a, cdbSNP:113545781
655+a, gdbSNP:11537700
660+c, tdbSNP:11537698
673+a, gdbSNP:199586303
702..703+, gdbSNP:367620507
723+c, tdbSNP:112759633
750+c, tdbSNP:267605629
751+c, tdbSNP:139229358
765+c, gdbSNP:111525410
772+c, tdbSNP:11537695
775+c, tdbSNP:113939958
779+a, gdbSNP:146859239
787+a, gdbSNP:200540971
790+a, gdbSNP:200123377
832+dbSNP:
832+c, gdbSNP:201816987
862+c, gdbSNP:140667985
902+a, tdbSNP:372716916
927+a, gdbSNP:201263415
940+c, tdbSNP:150469675
967+dbSNP:
967+a, gdbSNP:371185672
972+c, tdbSNP:199784281
973+a, gdbSNP:11537697
976+a, gdbSNP:145417094
979+c, tdbSNP:201531933
988+c, tdbSNP:149134744
1141+dbSNP:
1141+c, tdbSNP:11537699
1204+c, tdbSNP:371666912
1215+a, gdbSNP:376742581
1381+dbSNP:
1381+c, tdbSNP:370489148
1388+c, tdbSNP:373680053
1394+c, tdbSNP:377119375
1457+dbSNP:
1457+c, tdbSNP:370377898
1471+c, tdbSNP:143253734
1537+c, tdbSNP:139139629
1557..1558+, gdbSNP:138256580
1600+dbSNP:
1600+a, cdbSNP:201487228
1684+dbSNP:
1684+c, tdbSNP:144544128
1727+g, tdbSNP:200975975
1731+a, gdbSNP:141690261
1765+c, tdbSNP:187141962
1819+dbSNP:
1819+a, gdbSNP:80165164
1867+a, gdbSNP:147064842
1891+a, gdbSNP:141304480
1937+a, gdbSNP:376352060
1976+dbSNP:
1976+a, cdbSNP:368375470
1979+a, cdbSNP:199937493
1987+a, gdbSNP:138066943
2017+c, tdbSNP:10413435
2140+dbSNP:
2140+c, tdbSNP:369880957
2178+a, gdbSNP:111741898
2201+c, tdbSNP:41275804
2267+c, tdbSNP:112316360
complement(2310)-t, cdbSNP:137872459
2311+a, c, gdbSNP:113187868
2416+c, gdbSNP:369518763
2425+g, tdbSNP:80257415
2438+a, gdbSNP:149542408
2447+g, tdbSNP:374801536
2454+a, tdbSNP:369013078
2463+a, tdbSNP:372430948
Gene SymbolPPP2R1A
Gene SynonymPP2A-Aalpha; PP2AAALPHA; PR65A
Chromosome19
Locus Map19q13.41
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014225 Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA. In-stock $639.00 $590.00 15
Title Infrequent mutations of the PPP2R1A and PPP2R1B genes in patients with ovarian cancer .
Author Wang F, Zou Y, Liu FY, Yu XH, Huang H, Zhang N, Qi YY, Liu RF, Liu XY, Chen J, Huang OP and He M.
Journal Mol Med Rep 7 (6), 1826-1830 (2013)
Title PPP2R1A mutation is a rare event in ovarian carcinoma across histological subtypes .
Author Rahman M, Nakayama K, Rahman MT, Nakayama N, Katagiri H, Katagiri A, Ishibashi T, Ishikawa M, Iida K, Otsuki Y, Nakayama S and Miyazaki K.
Journal Anticancer Res. 33 (1), 113-118 (2013)
Title Role of a novel functional variant in the PPP2R1A promoter on the regulation of PP2A-Aalpha and the risk of hepatocellular carcinoma .
Author Chen HF, Mai JR, Wan JX, Gao YF, Lin LN, Wang SZ, Chen YX, Zhang CZ, Zhang YJ, Xia B, Liao K, Lin YC and Lin ZN.
Journal PLoS ONE 8 (3), E59574 (2013)
Title PPP2R1A mutations are common in the serous type of endometrial cancer .
Author Nagendra DC, Burke J 3rd, Maxwell GL and Risinger JI.
Journal Mol. Carcinog. 51 (10), 826-831 (2012)
Title Identification and functional analyses of polymorphism haplotypes of protein phosphatase 2A-Aalpha gene promoter .
Author Lin YC, Chen HF, Lin LN, Luo J, Li W, Zhang SJ, Li XJ, Hu YM, Chen YX, Chen W and Lin ZN.
Journal Mutat. Res. 716 (1-2), 66-75 (2011)
Title Identification of a new family of protein phosphatase 2A regulatory subunits .
Author McCright B and Virshup DM.
Journal J. Biol. Chem. 270 (44), 26123-26128 (1995)
Title Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function .
Author Golsteyn RM, Mundt KE, Fry AM and Nigg EA.
Journal J. Cell Biol. 129 (6), 1617-1628 (1995)
Title alpha- and beta-forms of the 65-kDa subunit of protein phosphatase 2A have a similar 39 amino acid repeating structure .
Author Hemmings BA, Adams-Pearson C, Maurer F, Muller P, Goris J, Merlevede W, Hofsteenge J and Stone SR.
Journal Biochemistry 29 (13), 3166-3173 (1990)
Title Association of protein phosphatase 2A with polyoma virus medium tumor antigen .
Author Walter G, Ruediger R, Slaughter C and Mumby M.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (7), 2521-2525 (1990)
Title Molecular cloning and sequence of cDNA encoding polyoma medium tumor antigen-associated 61-kDa protein .
Author Walter G, Ferre F, Espiritu O and Carbone-Wiley A.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (22), 8669-8672 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.