• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014225 Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_014225.5, 294774554
Length 2519 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA.
Product serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
Comment

Summary: This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described. [provided by RefSeq, Apr 2010].


Transcript Variant: This variant (1) represents the longer transcript and encodes the functional protein.

RefSeq NP_055040.2
CDS 296..2065
Misc Feature(1)272..274
Misc Feature(2)317..1492
Misc Feature(3)317..1492
Misc Feature(4)434..1258
Misc Feature(5)548..1012
Misc Feature(6)791..883
Misc Feature(7)830..988
Misc Feature(8)929..1201
Misc Feature(9)1133..1135
Misc Feature(10)1493..2062
Misc Feature(11)1757..2044
Exon (1)1..373
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (2)374..464
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (3)465..565
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (4)566..798
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (5)799..946
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (6)947..1102
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (7)1103..1217
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (8)1218..1288
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (9)1289..1423
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (10)1424..1597
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (11)1598..1658
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (12)1659..1813
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (13)1814..1956
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (14)1957..2048
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Exon (15)2049..2509
Gene:PPP2R1A
Gene Synonym:PP2A-Aalpha; PP2AAALPHA; PR65A
Translation MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
23+dbSNP:
23+c, gdbSNP:112009029
106+a, gdbSNP:184163465
126..127+, adbSNP:34945683
150+c, gdbSNP:112621280
223+c, tdbSNP:13344984
235..236+, cdbSNP:74524008
236..237+, c, cccdbSNP:67495004
239..240+, tcdbSNP:112482978
240..241+, adbSNP:200079168
243..244+, tdbSNP:201332370
243+c, g, tdbSNP:111861947
244..245+a, gdbSNP:17554825
244+a, g, tdbSNP:113671789
244+, c, cccdbSNP:3833207
245+a, cdbSNP:62109200
246+a, gdbSNP:200899936
276+a, gdbSNP:199921290
307+c, tdbSNP:140334526
334+c, tdbSNP:201882921
343..344+c, tdbSNP:11537694
487+dbSNP:
487+g, tdbSNP:11537696
554+c, tdbSNP:144146832
579+dbSNP:
579+c, tdbSNP:148604195
580+a, gdbSNP:142069409
632+a, cdbSNP:113545781
655+a, gdbSNP:11537700
660+c, tdbSNP:11537698
673+a, gdbSNP:199586303
723+c, tdbSNP:112759633
751+c, tdbSNP:139229358
765+c, gdbSNP:111525410
772+c, tdbSNP:11537695
775+c, tdbSNP:113939958
779+a, gdbSNP:146859239
787+a, gdbSNP:200540971
790+a, gdbSNP:200123377
832+dbSNP:
832+c, gdbSNP:201816987
862+c, gdbSNP:140667985
927+a, gdbSNP:201263415
940+c, tdbSNP:150469675
972+dbSNP:
972+c, tdbSNP:199784281
973+a, gdbSNP:11537697
976+a, gdbSNP:145417094
979+c, tdbSNP:201531933
988+c, tdbSNP:149134744
1141+dbSNP:
1141+c, tdbSNP:11537699
1471+dbSNP:
1471+c, tdbSNP:143253734
1537+c, tdbSNP:139139629
1557..1558+, gdbSNP:138256580
1600+dbSNP:
1600+a, cdbSNP:201487228
1684+dbSNP:
1684+c, tdbSNP:144544128
1727+g, tdbSNP:200975975
1731+a, gdbSNP:141690261
1765+c, tdbSNP:187141962
1819+dbSNP:
1819+a, gdbSNP:80165164
1867+a, gdbSNP:147064842
1891+a, gdbSNP:141304480
1979+dbSNP:
1979+a, cdbSNP:199937493
1987+a, gdbSNP:138066943
2017+c, tdbSNP:10413435
2178+dbSNP:
2178+a, gdbSNP:111741898
2201+c, tdbSNP:41275804
2267+c, tdbSNP:112316360
2310+c, tdbSNP:137872459
2311+a, c, gdbSNP:113187868
2425+g, tdbSNP:80257415
2438+a, gdbSNP:149542408
Gene SymbolPPP2R1A
Gene SynonymPP2A-Aalpha; PP2AAALPHA; PR65A
Chromosome19
Locus Map19q13.41
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014225 Homo sapiens protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1, mRNA. In-stock $639.00 $590.00 15
Title PPP2R1A mutations are common in the serous type of endometrial cancer .
Author Nagendra,D.C., Burke,J. III, Maxwell,G.L. and Risinger,J.I.
Journal Mol. Carcinog. 51 (10), 826-831 (2012)
Title Identification and functional analyses of polymorphism haplotypes of protein phosphatase 2A-Aalpha gene promoter .
Author Lin,Y.C., Chen,H.F., Lin,L.N., Luo,J., Li,W., Zhang,S.J., Li,X.J., Hu,Y.M., Chen,Y.X., Chen,W. and Lin,Z.N.
Journal Mutat. Res. 716 (1-2), 66-75 (2011)
Title Somatic mutations of PPP2R1A in ovarian and uterine carcinomas .
Author Shih,Ie.M., Panuganti,P.K., Kuo,K.T., Mao,T.L., Kuhn,E., Jones,S., Velculescu,V.E., Kurman,R.J. and Wang,T.L.
Journal Am. J. Pathol. 178 (4), 1442-1447 (2011)
Title Subtype-specific mutation of PPP2R1A in endometrial and ovarian carcinomas .
Author McConechy,M.K., Anglesio,M.S., Kalloger,S.E., Yang,W., Senz,J., Chow,C., Heravi-Moussavi,A., Morin,G.B., Mes-Masson,A.M., Carey,M.S., McAlpine,J.N., Kwon,J.S., Prentice,L.M., Boyd,N., Shah,S.P., Gilks,C.B. and Huntsman,D.G.
Journal J. Pathol. 223 (5), 567-573 (2011)
Title Dephosphorylation of Carma1 by PP2A negatively regulates T-cell activation .
Author Eitelhuber,A.C., Warth,S., Schimmack,G., Duwel,M., Hadian,K., Demski,K., Beisker,W., Shinohara,H., Kurosaki,T., Heissmeyer,V. and Krappmann,D.
Journal EMBO J. 30 (3), 594-605 (2011)
Title Identification of a new family of protein phosphatase 2A regulatory subunits .
Author McCright,B. and Virshup,D.M.
Journal J. Biol. Chem. 270 (44), 26123-26128 (1995)
Title Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function .
Author Golsteyn,R.M., Mundt,K.E., Fry,A.M. and Nigg,E.A.
Journal J. Cell Biol. 129 (6), 1617-1628 (1995)
Title alpha- and beta-forms of the 65-kDa subunit of protein phosphatase 2A have a similar 39 amino acid repeating structure .
Author Hemmings,B.A., Adams-Pearson,C., Maurer,F., Muller,P., Goris,J., Merlevede,W., Hofsteenge,J. and Stone,S.R.
Journal Biochemistry 29 (13), 3166-3173 (1990)
Title Association of protein phosphatase 2A with polyoma virus medium tumor antigen .
Author Walter,G., Ruediger,R., Slaughter,C. and Mumby,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (7), 2521-2525 (1990)
Title Molecular cloning and sequence of cDNA encoding polyoma medium tumor antigen-associated 61-kDa protein .
Author Walter,G., Ferre,F., Espiritu,O. and Carbone-Wiley,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (22), 8669-8672 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.