• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 2 homeobox 3 (POU2F3), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_014352 Homo sapiens POU class 2 homeobox 3 (POU2F3), transcript variant 1, mRNA. ORF Sequence $380.19
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_014352.3, 347658962
Length 3013 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens POU class 2 homeobox 3 (POU2F3), transcript variant 1, mRNA.
Product POU domain, class 2, transcription factor 3 isoform 1
Comment

Summary: This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011].


Transcript Variant: This variant (1) represents the longer transcript and encodes the shorter isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_055167.2
CDS 151..1461
Misc Feature(1)697..921
Misc Feature(2)697..921
Misc Feature(3)994..1164
Misc Feature(4)order(994..1008,1012..1014,1063..1065,1081..1083,
Misc Feature(5)order(1000..1002,1009..1011,1129..1131,1138..1143,
Exon (1)1..178
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (2)179..247
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (3)248..282
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (4)283..408
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (5)409..511
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (6)512..594
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (7)595..777
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (8)778..919
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (9)920..1056
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (10)1057..1218
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (11)1219..1285
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (12)1286..1421
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Exon (13)1422..3013
Gene:POU2F3
Gene Synonym:Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Translation MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSH RPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQ GLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG GADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK NMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEKRF QDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPPVYNSRLVSPS GSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF NSSGSWYRWNHSTYLH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
139+c, gdbSNP:10790371
187+dbSNP:
187+a, tdbSNP:201301538
205+a, gdbSNP:201020292
213+a, gdbSNP:150562013
220+c, tdbSNP:150644971
257+dbSNP:
257+a, gdbSNP:200756719
291+dbSNP:
291+c, gdbSNP:139585451
307+g, tdbSNP:149689245
361+a, gdbSNP:145496153
369+c, tdbSNP:113447905
428+dbSNP:
428+c, tdbSNP:199908870
509+a, gdbSNP:139221088
510+a, cdbSNP:143953974
526+dbSNP:
526+a, cdbSNP:146425412
553+a, gdbSNP:200455762
585+a, gdbSNP:140710784
589+a, tdbSNP:143843036
596+dbSNP:
596+c, tdbSNP:201145362
599+c, tdbSNP:151083714
604+c, tdbSNP:202027996
605+a, g, tdbSNP:7110845
654+c, gdbSNP:150249219
665+c, tdbSNP:139093583
696+c, tdbSNP:201298803
928+dbSNP:
928+c, gdbSNP:201865274
1004+a, gdbSNP:143121284
1009+a, cdbSNP:147033976
1028+a, gdbSNP:138343985
1043+a, tdbSNP:149531239
1098+dbSNP:
1098+a, gdbSNP:35602880
1116+a, gdbSNP:148695404
1162+c, tdbSNP:202225394
1190+c, tdbSNP:149496403
1194+a, gdbSNP:146242937
1211+c, gdbSNP:201319590
1214+c, tdbSNP:77550935
1290+dbSNP:
1290+a, gdbSNP:144064421
1312+a, gdbSNP:113676807
1319+c, tdbSNP:2282537
1320+a, gdbSNP:139827446
1347+c, tdbSNP:147219684
1399+a, gdbSNP:150057507
1464+dbSNP:
1464+a, cdbSNP:190020776
1566+a, gdbSNP:140667393
1621+a, gdbSNP:61898346
1719+a, gdbSNP:144375055
1772..1773+, ttdbSNP:3832733
1772+, ttdbSNP:34960456
1773+a, gdbSNP:200541107
1963+a, tdbSNP:112050659
2062+c, tdbSNP:75477342
2063+a, gdbSNP:146080572
2124+g, tdbSNP:112894319
2225+c, tdbSNP:151121242
2243+c, tdbSNP:73578283
2287..2288+, gdbSNP:35061338
2420+c, gdbSNP:141117331
2434..2435+, gdbSNP:201098205
2434+a, gdbSNP:112976121
2501+c, tdbSNP:78221919
2507+c, tdbSNP:4938797
2513+c, tdbSNP:200901486
2514+c, tdbSNP:4938798
2518+c, tdbSNP:78177158
2519+c, tdbSNP:185314501
2598+c, tdbSNP:188928459
2602+c, tdbSNP:181535671
2622+a, gdbSNP:11217815
2641+c, tdbSNP:145483650
2767+c, tdbSNP:141111966
2804+c, tdbSNP:112541714
2933..2934+, adbSNP:200735927
2934+c, tdbSNP:200773770
Gene SymbolPOU2F3
Gene SynonymEpoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
Chromosome11
Locus Map11q23.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001244682 Homo sapiens POU class 2 homeobox 3 (POU2F3), transcript variant 2, mRNA. Full Length $841.87
ORF Sequence $381.93
NM_014352 Homo sapiens POU class 2 homeobox 3 (POU2F3), transcript variant 1, mRNA. Full Length $1054.55
ORF Sequence $380.19
Title Relation between the expression levels of the POU transcription factors Skn-1a and Skn-1n and keratinocyte differentiation .
Author Takemoto,H., Tamai,K., Akasaka,E., Rokunohe,D., Takiyoshi,N., Umegaki,N., Nakajima,K., Aizu,T., Kaneko,T., Nakano,H. and Sawamura,D.
Journal J. Dermatol. Sci. 60 (3), 203-205 (2010)
Title Skn-1a/Oct-11 and DeltaNp63alpha exert antagonizing effects on human keratin expression .
Author Lena,A.M., Cipollone,R., Amelio,I., Catani,M.V., Ramadan,S., Browne,G., Melino,G. and Candi,E.
Journal Biochem. Biophys. Res. Commun. 401 (4), 568-573 (2010)
Title Transcription factor human Skn-1a enhances replication of human papillomavirus DNA through the direct binding to two sites near the viral replication origin .
Author Kukimoto,I., Mori,S., Sato,H., Takeuchi,T. and Kanda,T.
Journal FEBS J. 275 (12), 3123-3135 (2008)
Title Identification of Skn-1n, a splice variant induced by high calcium concentration and specifically expressed in normal human keratinocytes .
Author Nakajima,K., Tamai,K., Yamazaki,T., Toyomaki,Y., Nakano,H., Uitto,J. and Sawamura,D.
Journal J. Invest. Dermatol. 128 (5), 1336-1339 (2008)
Title Aberrant promoter methylation and silencing of the POU2F3 gene in cervical cancer .
Author Zhang,Z., Huettner,P.C., Nguyen,L., Bidder,M., Funk,M.C., Li,J. and Rader,J.S.
Journal Oncogene 25 (39), 5436-5445 (2006)
Title Distinct functional interactions of human Skn-1 isoforms with Ese-1 during keratinocyte terminal differentiation .
Author Cabral,A., Fischer,D.F., Vermeij,W.P. and Backendorf,C.
Journal J. Biol. Chem. 278 (20), 17792-17799 (2003)
Title The POU domain factor Skin-1a represses the keratin 14 promoter independent of DNA binding. A possible role for interactions between Skn-1a and CREB-binding protein/p300 .
Author Sugihara,T.M., Kudryavtseva,E.I., Kumar,V., Horridge,J.J. and Andersen,B.
Journal J. Biol. Chem. 276 (35), 33036-33044 (2001)
Title Characterization of the regulatory domains of the human skn-1a/Epoc-1/Oct-11 POU transcription factor .
Author Hildesheim,J., Foster,R.A., Chamberlin,M.E. and Vogel,J.C.
Journal J. Biol. Chem. 274 (37), 26399-26406 (1999)
Title Functions of the POU domain genes Skn-1a/i and Tst-1/Oct-6/SCIP in epidermal differentiation .
Author Andersen,B., Weinberg,W.C., Rennekampff,O., McEvilly,R.J., Bermingham,J.R. Jr., Hooshmand,F., Vasilyev,V., Hansbrough,J.F., Pittelkow,M.R., Yuspa,S.H. and Rosenfeld,M.G.
Journal Genes Dev. 11 (14), 1873-1884 (1997)
Title Cloning, chromosomal localization and expression pattern of the POU domain gene Oct-11 .
Author Goldsborough,A.S., Healy,L.E., Copeland,N.G., Gilbert,D.J., Jenkins,N.A., Willison,K.R. and Ashworth,A.
Journal Nucleic Acids Res. 21 (1), 127-134 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878