• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_014368.4, 334191686
Length 3444 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA.
Product LIM/homeobox protein Lhx6 isoform 1
Comment

Summary: This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1).


##Evidence-Data-START## Transcript exon combination :: AL136570.1, BC103937.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025085 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055183.2
CDS 73..1251
Misc Feature(1)367..528
Misc Feature(2)367..528
Misc Feature(3)order(367..369,376..378,430..432,439..441,448..450,
Misc Feature(4)550..714
Misc Feature(5)order(550..552,559..561,616..618,625..627,634..636,
Misc Feature(6)817..990
Misc Feature(7)order(817..831,835..837,886..888,904..906,943..945,
Misc Feature(8)order(823..825,832..834,952..954,961..966,973..975)
Exon (1)1..156
Gene:LHX6
Gene Synonym:LHX6.1
Exon (2)157..228
Gene:LHX6
Gene Synonym:LHX6.1
Exon (3)229..411
Gene:LHX6
Gene Synonym:LHX6.1
Exon (4)412..533
Gene:LHX6
Gene Synonym:LHX6.1
Exon (5)534..754
Gene:LHX6
Gene Synonym:LHX6.1
Exon (6)755..855
Gene:LHX6
Gene Synonym:LHX6.1
Exon (7)856..951
Gene:LHX6
Gene Synonym:LHX6.1
Exon (8)952..1126
Gene:LHX6
Gene Synonym:LHX6.1
Exon (9)1127..1230
Gene:LHX6
Gene Synonym:LHX6.1
Exon (10)1231..3434
Gene:LHX6
Gene Synonym:LHX6.1
Translation MYWKHENAAPALPEGCRLPAEGGPATDQVMAQPGSGCKATTRCLEGTAPPAMAQSDAEAL AGALDKDEGQASPCTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWH VRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNA YHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSE QDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCR ARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVH CRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(333)-dbSNP:
complement(333)-g, adbSNP:138880738
complement(384)-g, cdbSNP:114083078
complement(396)-t, gdbSNP:185007094
complement(468)-dbSNP:
complement(468)-t, cdbSNP:150186287
complement(521)-g, adbSNP:114142278
complement(630)-dbSNP:
complement(630)-g, adbSNP:116345380
complement(648)-t, cdbSNP:141830577
complement(679)-g, adbSNP:201468383
complement(724)-t, cdbSNP:201011938
complement(768)-dbSNP:
complement(768)-t, cdbSNP:148096760
complement(794)-t, cdbSNP:200081104
complement(841)-t, cdbSNP:141012050
complement(1010)-dbSNP:
complement(1010)-t, gdbSNP:142314211
complement(1017)-g, cdbSNP:11789619
complement(1022)-g, cdbSNP:113280031
complement(1140)-dbSNP:
complement(1140)-g, adbSNP:202183953
complement(1177)-t, gdbSNP:41273919
complement(1196)-t, cdbSNP:200077245
complement(1202)-t, cdbSNP:199844488
complement(1210)-t, gdbSNP:146076339
complement(1253)-dbSNP:
complement(1253)-g, adbSNP:11540516
complement(1299)-t, cdbSNP:1065351
complement(1448)-g, adbSNP:74370188
complement(1492)-t, adbSNP:191293623
complement(1585)-g, adbSNP:78827082
complement(1586)-t, cdbSNP:187853257
complement(1624)-g, adbSNP:113235907
complement(1759..1760)-, tadbSNP:58532716
complement(1760..1761)-, atdbSNP:10568818
complement(1784)-g, cdbSNP:182728290
complement(1841)-t, cdbSNP:3793617
complement(1848)-g, adbSNP:145835146
complement(1949)-t, cdbSNP:190733724
complement(2029)-g, adbSNP:3750486
complement(2176)-t, cdbSNP:186265474
complement(2280)-c, adbSNP:112237338
complement(2396)-t, cdbSNP:149824889
complement(2403)-g, adbSNP:181437437
complement(2587)-g, adbSNP:116126639
complement(2588)-t, cdbSNP:10985563
complement(2596)-t, cdbSNP:139808718
complement(2838)-g, adbSNP:146087682
complement(2855)-t, gdbSNP:75374421
complement(2873)-t, cdbSNP:144211662
complement(2985)-g, cdbSNP:56092166
complement(3230)-t, cdbSNP:190568182
complement(3244)-g, cdbSNP:186921183
complement(3297)-g, cdbSNP:78509080
complement(3299)-t, cdbSNP:75280874
complement(3353)-t, gdbSNP:79457316
Gene SymbolLHX6
Gene SynonymLHX6.1
Chromosome9
Locus Map9q33.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001242333 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 3, mRNA. On-demand $549.00 14
NM_001242334 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 4, mRNA. In-stock $418.00 $369.00 10
NM_001242335 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 5, mRNA. In-stock $308.00 $259.00 10
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
NM_199160 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 2, mRNA. On-demand TBD TBD
Title The LIM homeodomain transcription factor LHX6: a transcriptional repressor that interacts with pituitary homeobox 2 (PITX2) to regulate odontogenesis .
Author Zhang,Z., Gutierrez,D., Li,X., Bidlack,F., Cao,H., Wang,J., Andrade,K., Margolis,H.C. and Amendt,B.A.
Journal J. Biol. Chem. 288 (4), 2485-2500 (2013)
Title Evaluation of the LIM homeobox genes LHX6 and LHX8 as candidates for Tourette syndrome .
Author Paschou,P., Stylianopoulou,E., Karagiannidis,I., Rizzo,R., Tarnok,Z., Wolanczyk,T., Hebebrand,J., Nothen,M.M., Lehmkuhl,G., Farkas,L., Nagy,P., Szymanska,U., Lykidis,D., Androutsos,C., Tsironi,V., Koumoula,A., Barta,C., Klidonas,S., Ypsilantis,P., Simopoulos,C., Skavdis,G. and Grigoriou,M.
Journal Genes Brain Behav. 11 (4), 444-451 (2012)
Title Epigenetic regulation of the potential tumor suppressor gene, hLHX6.1, in human cervical cancer .
Author Jung,S., Jeong,D., Kim,J., Yi,L., Koo,K., Lee,J., Kim,C.J., Kim,C.H., An,S., Yang,Y., Lim,J.S., Kim,K.I. and Lee,M.S.
Journal Int. J. Oncol. 38 (3), 859-869 (2011)
Title The role of hLHX6-HMR as a methylation biomarker for early diagnosis of cervical cancer .
Author Jung,S., Jeong,D., Kim,J., Yi,L., Koo,K., Lee,J., Lee,S.D., Park,J.W., Chang,B., Kim,C.H., Kim,C.J. and Lee,M.S.
Journal Oncol. Rep. 23 (6), 1675-1682 (2010)
Title Human variation in alcohol response is influenced by variation in neuronal signaling genes .
Author Joslyn,G., Ravindranathan,A., Brush,G., Schuckit,M. and White,R.L.
Journal Alcohol. Clin. Exp. Res. 34 (5), 800-812 (2010)
Title LHX6 is a sensitive methylation marker in head and neck carcinomas .
Author Estecio,M.R., Youssef,E.M., Rahal,P., Fukuyama,E.E., Gois-Filho,J.F., Maniglia,J.V., Goloni-Bertollo,E.M., Issa,J.P. and Tajara,E.H.
Journal Oncogene 25 (36), 5018-5026 (2006)
Title DNA sequence and analysis of human chromosome 9 .
Author Humphray,S.J., Oliver,K., Hunt,A.R., Plumb,R.W., Loveland,J.E., Howe,K.L., Andrews,T.D., Searle,S., Hunt,S.E., Scott,C.E., Jones,M.C., Ainscough,R., Almeida,J.P., Ambrose,K.D., Ashwell,R.I., Babbage,A.K., Babbage,S., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J., Barlow,K.F., Bates,K., Beasley,H., Beasley,O., Bird,C.P., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D., Burrill,W., Burton,J., Carder,C., Carter,N.P., Chapman,J.C., Chen,Y., Clarke,G., Clark,S.Y., Clee,C.M., Clegg,S., Collier,R.E., Corby,N., Crosier,M., Cummings,A.T., Davies,J., Dhami,P., Dunn,M., Dutta,I., Dyer,L.W., Earthrowl,M.E., Faulkner,L., Fleming,C.J., Frankish,A., Frankland,J.A., French,L., Fricker,D.G., Garner,P., Garnett,J., Ghori,J., Gilbert,J.G., Glison,C., Grafham,D.V., Gribble,S., Griffiths,C., Griffiths-Jones,S., Grocock,R., Guy,J., Hall,R.E., Hammond,S., Harley,J.L., Harrison,E.S., Hart,E.A., Heath,P.D., Henderson,C.D., Hopkins,B.L., Howard,P.J., Howden,P.J., Huckle,E., Johnson,C., Johnson,D., Joy,A.A., Kay,M., Keenan,S., Kershaw,J.K., Kimberley,A.M., King,A., Knights,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A., Leversha,M., Lloyd,C., Lloyd,D.M., Lovell,J., Martin,S., Mashreghi-Mohammadi,M., Matthews,L., McLaren,S., McLay,K.E., McMurray,A., Milne,S., Nickerson,T., Nisbett,J., Nordsiek,G., Pearce,A.V., Peck,A.I., Porter,K.M., Pandian,R., Pelan,S., Phillimore,B., Povey,S., Ramsey,Y., Rand,V., Scharfe,M., Sehra,H.K., Shownkeen,R., Sims,S.K., Skuce,C.D., Smith,M., Steward,C.A., Swarbreck,D., Sycamore,N., Tester,J., Thorpe,A., Tracey,A., Tromans,A., Thomas,D.W., Wall,M., Wallis,J.M., West,A.P., Whitehead,S.L., Willey,D.L., Williams,S.A., Wilming,L., Wray,P.W., Young,L., Ashurst,J.L., Coulson,A., Blocker,H., Durbin,R., Sulston,J.E., Hubbard,T., Jackson,M.J., Bentley,D.R., Beck,S., Rogers,J. and Dunham,I.
Journal Nature 429 (6990), 369-374 (2004)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S.
Journal EMBO Rep. 1 (3), 287-292 (2000)
Title A brain region-specific gene product Lhx6.1 interacts with Ldb1 through tandem LIM-domains .
Author Kimura,N., Ueno,M., Nakashima,K. and Taga,T.
Journal J. Biochem. 126 (1), 180-187 (1999)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.