• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18448 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu18448C Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_014368.4, 334191686
Length 1179 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA.
Product LIM/homeobox protein Lhx6 isoform 1
Comment

Summary: This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1).


##Evidence-Data-START## Transcript exon combination :: AL136570.1, BC103937.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025086, ERS025089 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055183.2
CDS 73..1251
Misc Feature(1)367..528
Misc Feature(2)367..528
Misc Feature(3)order(367..369,376..378,430..432,439..441,448..450,
Misc Feature(4)550..714
Misc Feature(5)order(550..552,559..561,616..618,625..627,634..636,
Misc Feature(6)817..990
Misc Feature(7)order(817..831,835..837,886..888,904..906,943..945,
Misc Feature(8)order(823..825,832..834,952..954,961..966,973..975)
Exon (1)1..156
Gene:LHX6
Gene Synonym:LHX6.1
Exon (2)157..228
Gene:LHX6
Gene Synonym:LHX6.1
Exon (3)229..411
Gene:LHX6
Gene Synonym:LHX6.1
Exon (4)412..533
Gene:LHX6
Gene Synonym:LHX6.1
Exon (5)534..754
Gene:LHX6
Gene Synonym:LHX6.1
Exon (6)755..855
Gene:LHX6
Gene Synonym:LHX6.1
Exon (7)856..951
Gene:LHX6
Gene Synonym:LHX6.1
Exon (8)952..1126
Gene:LHX6
Gene Synonym:LHX6.1
Exon (9)1127..1230
Gene:LHX6
Gene Synonym:LHX6.1
Exon (10)1231..3434
Gene:LHX6
Gene Synonym:LHX6.1
Translation MYWKHENAAPALPEGCRLPAEGGPATDQVMAQPGSGCKATTRCLEGTAPPAMAQSDAEAL AGALDKDEGQASPCTPSTPSVCSPPSAASSVPSAGKNICSSCGLEILDRYLLKVNNLIWH VRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNA YHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSE QDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCR ARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVH CRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(60)-dbSNP:
complement(60)-t, cdbSNP:375357673
complement(178)-dbSNP:
complement(178)-g, cdbSNP:368987512
complement(333)-dbSNP:
complement(333)-g, adbSNP:138880738
complement(349)-g, adbSNP:368544328
complement(384)-g, cdbSNP:114083078
complement(396)-t, gdbSNP:185007094
complement(432)-dbSNP:
complement(432)-g, adbSNP:368399322
complement(468)-t, cdbSNP:150186287
complement(521)-g, adbSNP:114142278
complement(624)-dbSNP:
complement(624)-g, adbSNP:369599249
complement(630)-g, adbSNP:116345380
complement(648)-t, cdbSNP:141830577
complement(679)-g, adbSNP:201468383
complement(724)-t, cdbSNP:201011938
complement(768)-dbSNP:
complement(768)-t, cdbSNP:148096760
complement(794)-t, cdbSNP:200081104
complement(841)-t, cdbSNP:141012050
complement(1010)-dbSNP:
complement(1010)-t, gdbSNP:142314211
complement(1017)-g, cdbSNP:11789619
complement(1022)-g, cdbSNP:113280031
complement(1044)-g, adbSNP:373399550
complement(1100)-g, adbSNP:375958601
complement(1140)-dbSNP:
complement(1140)-g, adbSNP:202183953
complement(1141)-t, cdbSNP:373915153
complement(1157)-t, cdbSNP:371503306
complement(1172)-g, adbSNP:367663922
complement(1177)-t, gdbSNP:41273919
complement(1196)-t, cdbSNP:200077245
complement(1202)-t, cdbSNP:199844488
complement(1210)-t, gdbSNP:146076339
complement(1252)-dbSNP:
complement(1252)-g, adbSNP:370814560
1253+a, gdbSNP:11540516
complement(1254)-g, adbSNP:368168207
complement(1268)-c, adbSNP:374714258
complement(1285)-g, adbSNP:370896775
1299+c, tdbSNP:1065351
complement(1306)-t, cdbSNP:377581457
complement(1329)-g, adbSNP:373668070
complement(1448)-g, adbSNP:74370188
complement(1476)-t, cdbSNP:371254182
complement(1492)-t, adbSNP:191293623
complement(1585)-g, adbSNP:78827082
complement(1586)-t, cdbSNP:187853257
complement(1624)-g, adbSNP:113235907
complement(1759..1760)-, tadbSNP:58532716
complement(1760..1761)-, atdbSNP:10568818
complement(1784)-g, cdbSNP:182728290
complement(1841)-t, cdbSNP:3793617
complement(1848)-g, adbSNP:145835146
complement(1949)-t, cdbSNP:190733724
complement(2029)-g, adbSNP:3750486
complement(2176)-t, cdbSNP:186265474
complement(2280)-c, adbSNP:112237338
complement(2396)-t, cdbSNP:149824889
complement(2403)-g, adbSNP:181437437
complement(2587)-g, adbSNP:116126639
complement(2588)-t, cdbSNP:10985563
complement(2596)-t, cdbSNP:139808718
complement(2742)-t, cdbSNP:377359088
complement(2838)-g, adbSNP:146087682
complement(2840)-t, cdbSNP:367617466
complement(2855)-t, gdbSNP:75374421
complement(2873)-t, cdbSNP:144211662
complement(2985)-g, cdbSNP:56092166
complement(3230)-t, cdbSNP:190568182
complement(3244)-g, cdbSNP:186921183
complement(3278..3279)-, tdbSNP:368528168
complement(3297)-g, cdbSNP:78509080
complement(3299)-t, cdbSNP:75280874
complement(3353)-t, gdbSNP:79457316
Gene SymbolLHX6
Gene SynonymLHX6.1
Chromosome9
Locus Map9q33.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
NM_014368 Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA. On-demand TBD TBD
Title The LIM homeodomain transcription factor LHX6: a transcriptional repressor that interacts with pituitary homeobox 2 (PITX2) to regulate odontogenesis .
Author Zhang Z, Gutierrez D, Li X, Bidlack F, Cao H, Wang J, Andrade K, Margolis HC and Amendt BA.
Journal J. Biol. Chem. 288 (4), 2485-2500 (2013)
Title LHX6 acts as a novel potential tumour suppressor with epigenetic inactivation in lung cancer .
Author Liu WB, Jiang X, Han F, Li YH, Chen HQ, Liu Y, Cao J and Liu JY.
Journal Cell Death Dis 4, E882 (2013)
Title Evaluation of the LIM homeobox genes LHX6 and LHX8 as candidates for Tourette syndrome .
Author Paschou P, Stylianopoulou E, Karagiannidis I, Rizzo R, Tarnok Z, Wolanczyk T, Hebebrand J, Nothen MM, Lehmkuhl G, Farkas L, Nagy P, Szymanska U, Lykidis D, Androutsos C, Tsironi V, Koumoula A, Barta C, Klidonas S, Ypsilantis P, Simopoulos C, Skavdis G and Grigoriou M.
Journal Genes Brain Behav. 11 (4), 444-451 (2012)
Title Epigenetic regulation of the potential tumor suppressor gene, hLHX6.1, in human cervical cancer .
Author Jung S, Jeong D, Kim J, Yi L, Koo K, Lee J, Kim CJ, Kim CH, An S, Yang Y, Lim JS, Kim KI and Lee MS.
Journal Int. J. Oncol. 38 (3), 859-869 (2011)
Title The role of hLHX6-HMR as a methylation biomarker for early diagnosis of cervical cancer .
Author Jung S, Jeong D, Kim J, Yi L, Koo K, Lee J, Lee SD, Park JW, Chang B, Kim CH, Kim CJ and Lee MS.
Journal Oncol. Rep. 23 (6), 1675-1682 (2010)
Title Human variation in alcohol response is influenced by variation in neuronal signaling genes .
Author Joslyn G, Ravindranathan A, Brush G, Schuckit M and White RL.
Journal Alcohol. Clin. Exp. Res. 34 (5), 800-812 (2010)
Title LHX6 is a sensitive methylation marker in head and neck carcinomas .
Author Estecio MR, Youssef EM, Rahal P, Fukuyama EE, Gois-Filho JF, Maniglia JV, Goloni-Bertollo EM, Issa JP and Tajara EH.
Journal Oncogene 25 (36), 5018-5026 (2006)
Title DNA sequence and analysis of human chromosome 9 .
Author Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J and Dunham I.
Journal Nature 429 (6990), 369-374 (2004)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson JC, Wellenreuther R, Poustka A, Pepperkok R and Wiemann S.
Journal EMBO Rep. 1 (3), 287-292 (2000)
Title A brain region-specific gene product Lhx6.1 interacts with Ldb1 through tandem LIM-domains .
Author Kimura N, Ueno M, Nakashima K and Taga T.
Journal J. Biochem. 126 (1), 180-187 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.