• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, mRNA.


RefSeq Accession Definition Services Price Order
NM_014402 Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_014402.4, 98986462
Length 1585 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, mRNA.
Product cytochrome b-c1 complex subunit 8
Comment

Summary: This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BP294955.1, AU119402.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055217.2
CDS 75..323
Misc Feature(1)54..56
Misc Feature(2)78..317
Misc Feature(3)78..317
Exon (1)1..61
Gene:UQCRQ
Gene Synonym:MC3DN4; QCR8; QP-C; QPC; UQCR7
Exon (2)62..228
Gene:UQCRQ
Gene Synonym:MC3DN4; QCR8; QP-C; QPC; UQCR7
Exon (3)229..1585
Gene:UQCRQ
Gene Synonym:MC3DN4; QCR8; QP-C; QPC; UQCR7
Translation MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY TWGTEEFERSKRKNPAAYENDK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
45..46+dbSNP:
45..46+a, gdbSNP:11544804
51+a, gdbSNP:11544807
84+a, gdbSNP:137995316
96+a, cdbSNP:140851547
119+c, tdbSNP:150139635
128+c, gdbSNP:138646168
134+a, tdbSNP:149313520
158+g, tdbSNP:200567528
164+c, tdbSNP:146307558
182+c, gdbSNP:36093416
184+a, gdbSNP:201606663
205+a, gdbSNP:11544805
206+a, gdbSNP:142744191
208+c, tdbSNP:11544803
212+c, tdbSNP:14664
245+c, tdbSNP:11544802
249+a, cdbSNP:11544808
321+g, tdbSNP:201159889
334+c, tdbSNP:201494744
343+a, gdbSNP:200725534
425+c, tdbSNP:141098349
559+c, gdbSNP:116229809
655+a, gdbSNP:182167836
657+c, tdbSNP:4415070
687+c, tdbSNP:186810817
791+a, gdbSNP:190017949
945+g, tdbSNP:182652065
967+c, tdbSNP:144996711
981+a, cdbSNP:188040859
1001+a, gdbSNP:55767930
1046+a, gdbSNP:17166297
1080+a, gdbSNP:17624157
1127+a, gdbSNP:116542012
1161+g, tdbSNP:193054991
1205+g, tdbSNP:144955309
1293+a, cdbSNP:185184076
1401+a, tdbSNP:149048464
1412+a, gdbSNP:143132426
1497+, cdbSNP:67367845
1516+c, tdbSNP:254284
1527+a, gdbSNP:116236652
Gene SymbolUQCRQ
Gene SynonymMC3DN4; QCR8; QP-C; QPC; UQCR7
Chromosome5
Locus Map5q31.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_014402 Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, mRNA. Full Length $459.65
ORF Sequence $159.00
Title Mitochondrial respiratory chain in the colonic mucosal of patients with ulcerative colitis .
Author Sifroni,K.G., Damiani,C.R., Stoffel,C., Cardoso,M.R., Ferreira,G.K., Jeremias,I.C., Rezin,G.T., Scaini,G., Schuck,P.F., Dal-Pizzol,F. and Streck,E.L.
Journal Mol. Cell. Biochem. 342 (1-2), 111-115 (2010)
Title Genetic variants in nuclear-encoded mitochondrial genes influence .
Author Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M., Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D., Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
Journal PLoS ONE 5 (9), E12862 (2010)
Title Mitochondrial complex III deficiency associated with a homozygous mutation in UQCRQ .
Author Barel,O., Shorer,Z., Flusser,H., Ofir,R., Narkis,G., Finer,G., Shalev,H., Nasasra,A., Saada,A. and Birk,O.S.
Journal Am. J. Hum. Genet. 82 (5), 1211-1216 (2008)
Title Oxidative modification of mitochondrial respiratory complexes in response to the stress of Trypanosoma cruzi infection .
Author Wen,J.J. and Garg,N.
Journal Free Radic. Biol. Med. 37 (12), 2072-2081 (2004)
Title Ubiquinol-cytochrome-c reductase from human and bovine mitochondria .
Author Schagger,H., Brandt,U., Gencic,S. and von Jagow,G.
Journal Meth. Enzymol. 260, 82-96 (1995)
Title The small molecular mass ubiquinone-binding protein (QPc-9.5 kDa) in mitochondrial ubiquinol-cytochrome c reductase: isolation, ubiquinone-binding domain, and immunoinhibition .
Author Usui,S., Yu,L. and Yu,C.A.
Journal Biochemistry 29 (19), 4618-4626 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878