• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27789 Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu27789C Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_014402.4, 98986462
Length 249 bp
Structure linear
Update Date 01-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), mRNA.
Product cytochrome b-c1 complex subunit 8
Comment

Summary: This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BP294955.1, AU119402.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##


##RefSeq-Attributes-START## gene product(s) localized to mito. :: reported by MitoCarta ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055217.2
CDS 75..323
Misc Feature(1)54..56
Misc Feature(2)78..317
Misc Feature(3)78..317
Exon (1)1..61
Gene:UQCRQ
Gene Synonym:MC3DN4; QCR8; QP-C; QPC; UQCR7
Exon (2)62..228
Gene:UQCRQ
Gene Synonym:MC3DN4; QCR8; QP-C; QPC; UQCR7
Exon (3)229..1585
Gene:UQCRQ
Gene Synonym:MC3DN4; QCR8; QP-C; QPC; UQCR7
Translation MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY TWGTEEFERSKRKNPAAYENDK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
39+dbSNP:
39+a, cdbSNP:375402854
45..46+a, gdbSNP:11544804
51+a, gdbSNP:11544807
59+c, tdbSNP:369119794
83+c, gdbSNP:372148780
84+a, gdbSNP:137995316
96+a, cdbSNP:140851547
117+a, cdbSNP:376625602
119+c, tdbSNP:150139635
128+c, gdbSNP:138646168
155+c, tdbSNP:368396020
158+g, tdbSNP:200567528
164+c, tdbSNP:146307558
182+c, gdbSNP:36093416
184+a, gdbSNP:201606663
203+a, gdbSNP:372341523
205+a, gdbSNP:11544805
206+a, gdbSNP:142744191
208+c, tdbSNP:11544803
212+c, tdbSNP:14664
245+c, tdbSNP:11544802
249+a, cdbSNP:11544808
255+a, cdbSNP:369666769
262+a, gdbSNP:373714379
315+c, gdbSNP:377638751
321+g, tdbSNP:201159889
334+c, tdbSNP:201494744
337+a, gdbSNP:377408074
343+a, gdbSNP:200725534
354+c, gdbSNP:370276645
363+a, cdbSNP:374661391
425+c, tdbSNP:141098349
462+c, tdbSNP:368678488
559+c, gdbSNP:116229809
655+a, gdbSNP:182167836
657+c, tdbSNP:4415070
662+a, gdbSNP:372313352
687+c, tdbSNP:186810817
791+a, gdbSNP:190017949
945+g, tdbSNP:182652065
967+c, tdbSNP:144996711
981+a, cdbSNP:188040859
1001+a, gdbSNP:55767930
1046+a, gdbSNP:17166297
1080+a, gdbSNP:17624157
1127+a, gdbSNP:116542012
1161+g, tdbSNP:193054991
1205+g, tdbSNP:144955309
1293+a, cdbSNP:185184076
complement(1401)-t, adbSNP:149048464
1412+a, gdbSNP:143132426
complement(1497)-, cdbSNP:67367845
1516+c, tdbSNP:254284
1527+a, gdbSNP:116236652
Gene SymbolUQCRQ
Gene SynonymMC3DN4; QCR8; QP-C; QPC; UQCR7
Chromosome5
Locus Map5q31.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014402 Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), mRNA. In-stock $99.00 5-7
Title Mitochondrial respiratory chain in the colonic mucosal of patients with ulcerative colitis .
Author Sifroni KG, Damiani CR, Stoffel C, Cardoso MR, Ferreira GK, Jeremias IC, Rezin GT, Scaini G, Schuck PF, Dal-Pizzol F and Streck EL.
Journal Mol. Cell. Biochem. 342 (1-2), 111-115 (2010)
Title Genetic variants in nuclear-encoded mitochondrial genes influence .
Author Hendrickson SL, Lautenberger JA, Chinn LW, Malasky M, Sezgin E, Kingsley LA, Goedert JJ, Kirk GD, Gomperts ED, Buchbinder SP, Troyer JL and O'Brien SJ.
Journal PLoS ONE 5 (9), E12862 (2010)
Title Mitochondrial complex III deficiency associated with a homozygous mutation in UQCRQ .
Author Barel O, Shorer Z, Flusser H, Ofir R, Narkis G, Finer G, Shalev H, Nasasra A, Saada A and Birk OS.
Journal Am. J. Hum. Genet. 82 (5), 1211-1216 (2008)
Title Oxidative modification of mitochondrial respiratory complexes in response to the stress of Trypanosoma cruzi infection .
Author Wen JJ and Garg N.
Journal Free Radic. Biol. Med. 37 (12), 2072-2081 (2004)
Title Ubiquinol-cytochrome-c reductase from human and bovine mitochondria .
Author Schagger H, Brandt U, Gencic S and von Jagow G.
Journal Meth. Enzymol. 260, 82-96 (1995)
Title The small molecular mass ubiquinone-binding protein (QPc-9.5 kDa) in mitochondrial ubiquinol-cytochrome c reductase: isolation, ubiquinone-binding domain, and immunoinhibition .
Author Usui S, Yu L and Yu CA.
Journal Biochemistry 29 (19), 4618-4626 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.