• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 20 receptor, alpha (IL20RA), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014432 Homo sapiens interleukin 20 receptor, alpha (IL20RA), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_014432.2, 31083155
Length 3682 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 20 receptor, alpha (IL20RA), mRNA.
Product interleukin-20 receptor subunit alpha precursor
Comment

Summary: The protein encoded by this gene is a receptor for interleukin 20 (IL20), a cytokine that may be involved in epidermal function. The receptor of IL20 is a heterodimeric receptor complex consisting of this protein and interleukin 20 receptor beta (IL20B). This gene and IL20B are highly expressed in skin. The expression of both genes is found to be upregulated in Psoriasis. [provided by RefSeq, Jul 2008].

RefSeq NP_055247.2
CDS 434..2095
Misc Feature(1)389..391
Misc Feature(2)545..823
Misc Feature(3)order(737..739,788..790)
Misc Feature(4)order(791..796,800..805)
Misc Feature(5)836..1150
Misc Feature(6)1184..1246
Exon (1)1..521
Gene:IL20RA
Gene Synonym:IL-20R1; ZCYTOR7
Exon (2)522..657
Gene:IL20RA
Gene Synonym:IL-20R1; ZCYTOR7
Exon (3)658..836
Gene:IL20RA
Gene Synonym:IL-20R1; ZCYTOR7
Exon (4)837..1012
Gene:IL20RA
Gene Synonym:IL-20R1; ZCYTOR7
Exon (5)1013..1157
Gene:IL20RA
Gene Synonym:IL-20R1; ZCYTOR7
Exon (6)1158..1297
Gene:IL20RA
Gene Synonym:IL-20R1; ZCYTOR7
Exon (7)1298..3682
Gene:IL20RA
Gene Synonym:IL-20R1; ZCYTOR7
Translation MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE GLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLK YNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTL KDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRF FVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHL GYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLV DWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQ FMEEWGLYVQMEN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(35)-dbSNP:
complement(35)-g, adbSNP:186275591
complement(102)-c, adbSNP:11154905
complement(103)-g, adbSNP:11154904
complement(115)-t, cdbSNP:144525085
complement(119)-c, adbSNP:9689317
complement(139..140)-, cdbSNP:11441444
complement(211)-t, gdbSNP:180978406
complement(307)-t, cdbSNP:7341348
complement(313)-, gdbSNP:34265133
complement(537)-dbSNP:
complement(537)-c, adbSNP:148518676
complement(560)-t, cdbSNP:191996643
complement(576)-g, adbSNP:28409601
complement(581)-t, cdbSNP:144678811
complement(696)-dbSNP:
complement(696)-t, cdbSNP:142251595
complement(701)-t, cdbSNP:138995272
complement(738)-g, cdbSNP:146129043
complement(752)-g, cdbSNP:142983578
complement(793)-g, adbSNP:138262239
complement(809)-t, cdbSNP:199954231
complement(874)-dbSNP:
complement(874)-g, adbSNP:150333567
complement(901)-t, cdbSNP:201864884
complement(958)-t, cdbSNP:140193064
complement(963)-t, gdbSNP:146644651
complement(980)-t, cdbSNP:143005532
complement(1011)-g, adbSNP:142288648
complement(1013)-dbSNP:
complement(1013)-g, adbSNP:182207407
complement(1027)-t, cdbSNP:147634362
complement(1038)-g, adbSNP:145285325
complement(1039)-t, cdbSNP:9483975
complement(1041)-c, adbSNP:113214407
complement(1112)-g, adbSNP:201628125
complement(1113)-t, cdbSNP:200613350
complement(1153)-t, cdbSNP:141184008
complement(1208)-dbSNP:
complement(1208)-t, cdbSNP:1555498
complement(1230)-c, adbSNP:150022802
complement(1249)-g, adbSNP:147771649
complement(1256)-g, adbSNP:201653928
complement(1267)-g, adbSNP:139282838
complement(1371)-dbSNP:
complement(1371)-t, gdbSNP:150827676
complement(1395)-t, cdbSNP:143552862
complement(1404)-t, cdbSNP:200346796
complement(1437)-t, gdbSNP:140012085
complement(1503)-g, adbSNP:200934665
complement(1525)-t, cdbSNP:202196623
complement(1537)-t, gdbSNP:146162704
complement(1572)-g, adbSNP:201040616
complement(1577)-t, cdbSNP:1342642
complement(1605)-g, cdbSNP:148151877
complement(1635)-t, cdbSNP:202110323
complement(1638)-t, gdbSNP:144760979
complement(1709)-g, adbSNP:149273640
complement(1719)-t, cdbSNP:138424318
complement(1741)-t, cdbSNP:199949228
complement(1744)-t, cdbSNP:145789822
complement(1773)-t, cdbSNP:143448674
complement(1777)-g, adbSNP:137891903
complement(1785)-g, adbSNP:202028481
complement(1788)-g, cdbSNP:147020946
complement(1810)-g, adbSNP:188439628
complement(1878)-t, cdbSNP:201995170
complement(1893)-t, cdbSNP:200667492
complement(1912)-c, adbSNP:75409075
complement(1926)-t, gdbSNP:151197202
complement(1928)-g, adbSNP:113298325
complement(1957)-g, c, adbSNP:143111644
complement(1963)-g, adbSNP:148959606
complement(1966)-c, adbSNP:201684775
complement(1970)-t, cdbSNP:200592228
complement(1987)-t, cdbSNP:199704533
complement(2008)-t, cdbSNP:145775161
complement(2026)-t, cdbSNP:143676923
complement(2070)-g, cdbSNP:186439336
complement(2162)-t, cdbSNP:141167070
complement(2272)-c, adbSNP:180800340
complement(2328)-g, adbSNP:188274860
complement(2364)-c, adbSNP:76578405
complement(2482)-t, cdbSNP:148602084
complement(2499)-g, adbSNP:143965193
complement(2539)-t, cdbSNP:117482843
complement(2595)-t, cdbSNP:771956
complement(2669)-t, cdbSNP:185366641
complement(2690)-g, adbSNP:181337366
complement(2743)-g, adbSNP:41288971
complement(2785)-g, adbSNP:190090418
complement(2797)-t, gdbSNP:142412156
complement(2802)-g, adbSNP:185187932
complement(2880)-t, gdbSNP:1475119
complement(2973)-g, adbSNP:138423017
complement(3093)-g, adbSNP:193202621
complement(3222)-t, cdbSNP:145840527
complement(3243)-t, cdbSNP:78132480
complement(3320)-c, adbSNP:189430794
complement(3322)-g, cdbSNP:112358703
complement(3354)-g, adbSNP:185050659
complement(3388)-g, cdbSNP:1059232
complement(3418)-t, cdbSNP:35479404
complement(3424)-t, adbSNP:142142208
complement(3454)-c, adbSNP:41288969
complement(3468)-g, adbSNP:75523202
complement(3492)-t, cdbSNP:138961911
complement(3660)-g, adbSNP:1136546
complement(3666)-t, adbSNP:3199877
Gene SymbolIL20RA
Gene SynonymIL-20R1; ZCYTOR7
Chromosome6
Locus Map6q23.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014432 Homo sapiens interleukin 20 receptor, alpha (IL20RA), mRNA. On-demand $699.00 18
Title Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex .
Author Logsdon,N.J., Allen,C.E., Rajashankar,K.R. and Walter,M.R.
Journal Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 68 (PT 1), 89-92 (2012)
Title Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study .
Author Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A.
Journal Mutat. Res. 694 (1-2), 13-19 (2010)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Further association analysis of chr 6q22-24 suggests a role of IL-20RA polymorphisms in psoriasis .
Author Kingo,K., Mossner,R., Traks,T., Ratsep,R., Raud,K., Reimann,E., Kruger,U., Silm,H., Vasar,E., Reich,K. and Koks,S.
Journal J. Dermatol. Sci. 57 (1), 71-73 (2010)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title Interleukins 19, 20, and 24 signal through two distinct receptor complexes. Differences in receptor-ligand interactions mediate unique biological functions .
Author Parrish-Novak,J., Xu,W., Brender,T., Yao,L., Jones,C., West,J., Brandt,C., Jelinek,L., Madden,K., McKernan,P.A., Foster,D.C., Jaspers,S. and Chandrasekher,Y.A.
Journal J. Biol. Chem. 277 (49), 47517-47523 (2002)
Title Interleukin 24 (MDA-7/MOB-5) signals through two heterodimeric receptors, IL-22R1/IL-20R2 and IL-20R1/IL-20R2 .
Author Wang,M., Tan,Z., Zhang,R., Kotenko,S.V. and Liang,P.
Journal J. Biol. Chem. 277 (9), 7341-7347 (2002)
Title Cutting edge: STAT activation by IL-19, IL-20 and mda-7 through IL-20 receptor complexes of two types .
Author Dumoutier,L., Leemans,C., Lejeune,D., Kotenko,S.V. and Renauld,J.C.
Journal J. Immunol. 167 (7), 3545-3549 (2001)
Title Interleukin 20: discovery, receptor identification, and role in epidermal function .
Author Blumberg,H., Conklin,D., Xu,W.F., Grossmann,A., Brender,T., Carollo,S., Eagan,M., Foster,D., Haldeman,B.A., Hammond,A., Haugen,H., Jelinek,L., Kelly,J.D., Madden,K., Maurer,M.F., Parrish-Novak,J., Prunkard,D., Sexson,S., Sprecher,C., Waggie,K., West,J., Whitmore,T.E., Yao,L., Kuechle,M.K., Dale,B.A. and Chandrasekher,Y.A.
Journal Cell 104 (1), 9-19 (2001)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.