• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu40856 Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu40856C Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_014432.3, 524590112
Length 1662 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 1, mRNA.
Product interleukin-20 receptor subunit alpha isoform 1 precursor
Comment

Summary: This gene encodes a member of the type II cytokine receptor family. The encoded protein is a subunit of the receptor for interleukin 20, a cytokine that may be involved in epidermal function. The interleukin 20 receptor is a heterodimeric complex consisting of the encoded protein and interleukin 20 receptor beta. This gene and interleukin 20 receptor beta are highly expressed in skin, and are upregulated in psoriasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_055247.3
CDS 453..2114
Misc Feature(1)408..410
Misc Feature(2)564..842
Misc Feature(3)order(747..749,807..809)
Misc Feature(4)order(810..815,819..824)
Misc Feature(5)855..1160
Misc Feature(6)1203..1265
Exon (1)1..540
Gene:IL20RA
Gene Synonym:CRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Exon (2)541..676
Gene:IL20RA
Gene Synonym:CRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Exon (3)677..855
Gene:IL20RA
Gene Synonym:CRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Exon (4)856..1031
Gene:IL20RA
Gene Synonym:CRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Exon (5)1032..1176
Gene:IL20RA
Gene Synonym:CRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Exon (6)1177..1316
Gene:IL20RA
Gene Synonym:CRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Exon (7)1317..3701
Gene:IL20RA
Gene Synonym:CRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Translation MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE GLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLK YNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTL KDQSSEFKAKIIFWYVLPISITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRF FVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHL GYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLV DWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQ FMEEWGLYVQMEN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-g, adbSNP:372217544
complement(54)-g, adbSNP:186275591
complement(121)-c, adbSNP:11154905
complement(122)-g, adbSNP:11154904
complement(134)-t, cdbSNP:144525085
complement(138)-c, adbSNP:9689317
complement(230)-t, gdbSNP:180978406
complement(308)-t, cdbSNP:369212925
complement(321)-t, gdbSNP:375742734
complement(326)-t, cdbSNP:7341348
complement(331)-, gdbSNP:34265133
complement(449)-t, cdbSNP:371458650
complement(488)-t, cdbSNP:368017267
complement(556)-dbSNP:
complement(556)-c, adbSNP:148518676
complement(579)-t, cdbSNP:191996643
complement(595)-g, adbSNP:28409601
complement(600)-t, cdbSNP:144678811
complement(668)-t, cdbSNP:371374786
complement(715)-dbSNP:
complement(715)-t, cdbSNP:142251595
complement(720)-t, cdbSNP:138995272
complement(757)-g, cdbSNP:146129043
complement(771)-g, cdbSNP:142983578
complement(812)-g, adbSNP:138262239
complement(828)-t, cdbSNP:199954231
complement(835)-t, cdbSNP:374954861
complement(879)-dbSNP:
complement(879)-c, adbSNP:368638679
complement(893)-g, adbSNP:150333567
complement(912)-t, cdbSNP:374476894
complement(920)-t, cdbSNP:201864884
complement(977)-t, cdbSNP:140193064
complement(982)-t, gdbSNP:146644651
complement(999)-t, cdbSNP:143005532
complement(1030)-g, adbSNP:142288648
complement(1031)-t, cdbSNP:375320839
complement(1032)-dbSNP:
complement(1032)-g, adbSNP:182207407
complement(1046)-t, cdbSNP:147634362
complement(1057)-g, adbSNP:145285325
complement(1058)-t, cdbSNP:9483975
complement(1060)-c, adbSNP:113214407
complement(1082)-c, adbSNP:373289362
complement(1089)-g, cdbSNP:370436203
complement(1116)-t, cdbSNP:369006457
complement(1131)-g, adbSNP:201628125
complement(1132)-t, cdbSNP:200613350
complement(1172)-t, cdbSNP:141184008
complement(1227)-dbSNP:
complement(1227)-t, cdbSNP:1555498
complement(1237)-g, adbSNP:371958375
complement(1249)-c, adbSNP:150022802
complement(1268)-g, adbSNP:147771649
complement(1275)-g, adbSNP:201653928
complement(1286)-g, adbSNP:139282838
complement(1390)-dbSNP:
complement(1390)-t, gdbSNP:150827676
complement(1414)-t, cdbSNP:143552862
complement(1423)-t, cdbSNP:200346796
complement(1456)-t, gdbSNP:140012085
complement(1511)-t, cdbSNP:377604911
complement(1522)-g, adbSNP:200934665
complement(1544)-t, cdbSNP:202196623
complement(1556)-t, gdbSNP:146162704
complement(1568)-g, adbSNP:369652675
complement(1588)-t, cdbSNP:373486228
complement(1591)-g, adbSNP:201040616
1596+c, tdbSNP:1342642
complement(1624)-g, cdbSNP:148151877
complement(1654)-t, cdbSNP:202110323
complement(1657)-t, gdbSNP:144760979
complement(1728)-g, adbSNP:149273640
complement(1738)-t, cdbSNP:138424318
complement(1741)-g, adbSNP:377051637
complement(1760)-t, cdbSNP:199949228
complement(1763)-t, cdbSNP:145789822
complement(1780)-g, adbSNP:372856393
complement(1792)-t, cdbSNP:143448674
complement(1796)-g, adbSNP:137891903
complement(1804)-g, adbSNP:202028481
complement(1807)-g, cdbSNP:147020946
complement(1829)-g, adbSNP:188439628
complement(1897)-t, cdbSNP:201995170
complement(1912)-t, cdbSNP:200667492
complement(1913)-t, gdbSNP:368530776
complement(1927)-g, adbSNP:267600839
complement(1929)-g, adbSNP:375002361
complement(1931)-c, adbSNP:75409075
complement(1944)-c, adbSNP:371682783
complement(1945)-t, gdbSNP:151197202
complement(1947)-g, adbSNP:113298325
complement(1955)-t, cdbSNP:367552524
complement(1976)-g, c, adbSNP:143111644
complement(1982)-g, adbSNP:148959606
complement(1985)-c, adbSNP:201684775
complement(1989)-t, cdbSNP:200592228
complement(2006)-t, cdbSNP:199704533
complement(2027)-t, cdbSNP:145775161
complement(2045)-t, cdbSNP:143676923
complement(2089)-g, cdbSNP:186439336
complement(2175)-g, adbSNP:371502611
complement(2181)-t, cdbSNP:141167070
complement(2291)-c, adbSNP:180800340
complement(2347)-g, adbSNP:188274860
complement(2383)-c, adbSNP:76578405
complement(2501)-t, cdbSNP:148602084
complement(2518)-g, adbSNP:143965193
complement(2558)-t, cdbSNP:117482843
complement(2614)-t, cdbSNP:771956
complement(2688)-t, cdbSNP:185366641
complement(2709)-g, adbSNP:181337366
complement(2733)-g, adbSNP:372335160
complement(2762)-g, adbSNP:41288971
complement(2804)-g, adbSNP:190090418
2816+g, tdbSNP:142412156
complement(2821)-g, adbSNP:185187932
complement(2899)-t, gdbSNP:1475119
complement(2992)-g, adbSNP:138423017
complement(3112)-g, adbSNP:193202621
complement(3185)-t, cdbSNP:368485160
complement(3241)-t, cdbSNP:145840527
complement(3262)-t, cdbSNP:78132480
complement(3262)-g, adbSNP:386443504
complement(3339)-c, adbSNP:189430794
complement(3341)-g, cdbSNP:112358703
complement(3342)-g, adbSNP:377378024
complement(3373)-t, g, adbSNP:185050659
3407+c, gdbSNP:1059232
complement(3437)-t, cdbSNP:35479404
complement(3437)-t, cdbSNP:386478393
complement(3443)-t, adbSNP:142142208
complement(3473)-c, adbSNP:41288969
complement(3487)-t, cdbSNP:386443573
complement(3487)-g, adbSNP:75523202
complement(3511)-t, cdbSNP:138961911
complement(3583)-t, gdbSNP:374494139
3679+a, gdbSNP:1136546
3685+a, tdbSNP:3199877
Gene SymbolIL20RA
Gene SynonymCRF2-8; IL-20R-alpha; IL-20R1; IL-20RA
Chromosome6
Locus Map6q23.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001278723 Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 3, mRNA. On-demand $219.00 7-9
NM_001278724 Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 4, mRNA. On-demand $219.00 7-9
NM_001278722 Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_014432 Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant 1, mRNA. On-demand $219.00 7-9
XM_006715505 PREDICTED: Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_006715506 PREDICTED: Homo sapiens interleukin 20 receptor, alpha (IL20RA), transcript variant X2, mRNA. On-demand $219.00 7-9
Title Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex .
Author Logsdon NJ, Allen CE, Rajashankar KR and Walter MR.
Journal Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 68 (PT 1), 89-92 (2012)
Title Further association analysis of chr 6q22-24 suggests a role of IL-20RA polymorphisms in psoriasis .
Author Kingo,K., Mossner,R., Traks,T., Ratsep,R., Raud,K., Reimann,E., Kruger,U., Silm,H., Vasar,E., Reich,K. and Koks,S.
Journal J. Dermatol. Sci. 57 (1), 71-73 (2010)
Title Expression pattern of mda-7/IL-24 receptors in liver cancer cell lines .
Author Zhu H and Yang ZB.
Journal HBPD INT 8 (4), 402-406 (2009)
Title Association analysis of IL20RA and IL20RB genes in psoriasis .
Author Kingo K, Mossner R, Ratsep R, Raud K, Kruger U, Silm H, Vasar E, Reich K and Koks S.
Journal Genes Immun. 9 (5), 445-451 (2008)
Title The T-cell lymphokine interleukin-26 targets epithelial cells through the interleukin-20 receptor 1 and interleukin-10 receptor 2 chains .
Author Hor S, Pirzer H, Dumoutier L, Bauer F, Wittmann S, Sticht H, Renauld JC, de Waal Malefyt R and Fickenscher H.
Journal J. Biol. Chem. 279 (32), 33343-33351 (2004)
Title Characterization of the recombinant extracellular domains of human interleukin-20 receptors and their complexes with interleukin-19 and interleukin-20 .
Author Pletnev S, Magracheva E, Kozlov S, Tobin G, Kotenko SV, Wlodawer A and Zdanov A.
Journal Biochemistry 42 (43), 12617-12624 (2003)
Title Interleukins 19, 20, and 24 signal through two distinct receptor complexes. Differences in receptor-ligand interactions mediate unique biological functions .
Author Parrish-Novak J, Xu W, Brender T, Yao L, Jones C, West J, Brandt C, Jelinek L, Madden K, McKernan PA, Foster DC, Jaspers S and Chandrasekher YA.
Journal J. Biol. Chem. 277 (49), 47517-47523 (2002)
Title Interleukin 24 (MDA-7/MOB-5) signals through two heterodimeric receptors, IL-22R1/IL-20R2 and IL-20R1/IL-20R2 .
Author Wang M, Tan Z, Zhang R, Kotenko SV and Liang P.
Journal J. Biol. Chem. 277 (9), 7341-7347 (2002)
Title Cutting edge: STAT activation by IL-19, IL-20 and mda-7 through IL-20 receptor complexes of two types .
Author Dumoutier L, Leemans C, Lejeune D, Kotenko SV and Renauld JC.
Journal J. Immunol. 167 (7), 3545-3549 (2001)
Title Interleukin 20: discovery, receptor identification, and role in epidermal function .
Author Blumberg H, Conklin D, Xu WF, Grossmann A, Brender T, Carollo S, Eagan M, Foster D, Haldeman BA, Hammond A, Haugen H, Jelinek L, Kelly JD, Madden K, Maurer MF, Parrish-Novak J, Prunkard D, Sexson S, Sprecher C, Waggie K, West J, Whitmore TE, Yao L, Kuechle MK, Dale BA and Chandrasekher YA.
Journal Cell 104 (1), 9-19 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.