• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014472 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_014472.4, 140560993
Length 3386 bp
Structure linear
Update Date 02-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA.
Product coiled-coil domain-containing protein R3HCC1L isoform 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA114618.1, BC099848.1, AL139241.11 and BU678731.1. On Apr 4, 2007 this sequence version replaced gi:50593521.


Transcript Variant: This variant (4) differs in the 5' UTR and lacks an exon in the coding region, but maintains the reading frame, compared to variant 1. Variants 2, 3 and 4 encode the same isoform (2), which is shorter than isoform 1.


##Evidence-Data-START## Transcript exon combination :: BC099848.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055287.4
CDS 296..2632
Misc Feature(1)257..259
Misc Feature(2)314..376
Misc Feature(3)314..376
Misc Feature(4)2183..2377
Misc Feature(5)order(2210..2212,2216..2224,2279..2281,2285..2290)
Exon (1)1..83
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (2)84..176
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (3)177..281
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (4)282..2080
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (5)2081..2256
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (6)2257..2327
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (7)2328..2423
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (8)2424..2564
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (9)2565..3371
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Translation MQQESERCRVRARRPDMALYVPKARRGAVLLKTGDEEESCGSPNSVVKEKQKESSLSQKE VFKDKPEARRLNINPDRKEHNCREEKKSSTKLRMDTCLQKTNRVCSKRGTTESKEVLSQG QQQGAPNAGVITNAPLQRHFKPKKVECLEVETTDVTGHERILLSQACLEISEAQVPSKPF QNVEFCDFSRHEPDGEAFEDKDLEGRIETDTKVLEILYEFPRVFSSVMKPENMIVPIKLS SDSEIVQQSMQTSDGILNPSSGGITTTSVPGSPDGVFDQTCVDFEVESVGGIANSTGFIL DQKDTDSIPATMGHISLSESTNDTVSPVMIRECEKNDSTADELHVKHEPPDTAVLAHETH RDSGFKNVGDITNKACMMDTTGMSCSDHVTVDSPYVVAVRIADETSINTRSFSKFVGMSA DATPLHVARSGNDTEDFSNPSACSDIYGESISSHFTESTGKLIESLSDCASSLPIKKIAG SNYNTFLDSELSMLNGTKVLSDSAVGIDLGSTGDTTEALHELRTAEEFKTEEQDDSGSIE FGVSFPDRESSSMETSIEPKATETSHTEGITAIEESWESMFNDDGDCLDPRLLQELSGNT KSRESIQEPRSDYYNHEVPDIDLSDCEFPHVIEIYDFPQEFRTEDLLRVFCSYQKKGFDI KWVDDTHALGVFSSPITARDALGIKHTMVKIRPLSQATRAAKAKARAYAEFLQPAKERPE TSAALARRLVISALGVRSKQSKTEREAELKKLQEARERKRLEAKQREDIWEGRDQSTV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
18+dbSNP:
18+c, tdbSNP:41290470
74+c, tdbSNP:192268931
127+dbSNP:
127+a, gdbSNP:73323860
195+dbSNP:
195+a, tdbSNP:180704394
233+c, tdbSNP:185375222
264+a, gdbSNP:73323863
274+a, cdbSNP:190527072
288+dbSNP:
288+g, tdbSNP:372560284
312+a, gdbSNP:112811238
353+c, tdbSNP:201437571
359+c, tdbSNP:148941402
402+a, cdbSNP:375521100
501+a, gdbSNP:373657280
518+c, tdbSNP:370226522
519+c, gdbSNP:143631828
566+a, cdbSNP:372164414
589+c, tdbSNP:7903980
590+a, cdbSNP:7918729
606+a, tdbSNP:374768883
632+c, tdbSNP:12775148
686+a, gdbSNP:368848459
703+a, gdbSNP:370973175
731+a, gdbSNP:144192127
753+c, tdbSNP:372453818
758+a, gdbSNP:146588639
773+a, cdbSNP:183340020
776+a, gdbSNP:144063837
819+c, tdbSNP:371809764
829+a, tdbSNP:147319818
852+a, gdbSNP:369258826
855+a, gdbSNP:139280105
859+c, tdbSNP:376474765
865+a, gdbSNP:143198025
866+c, tdbSNP:373754800
867+a, cdbSNP:150756925
881+c, gdbSNP:199555861
884+a, gdbSNP:139067059
908+a, gdbSNP:201624301
915+c, tdbSNP:190456992
926+a, tdbSNP:140074350
959+a, gdbSNP:115631399
969+c, gdbSNP:143854962
1009+a, cdbSNP:7922159
1025+c, gdbSNP:114751718
1030+c, tdbSNP:146752413
1034+a, cdbSNP:139348217
1043+a, cdbSNP:376638744
1068+a, gdbSNP:142615551
1076+c, tdbSNP:35373035
1079+a, gdbSNP:140478396
1080+c, gdbSNP:368725724
1094+c, tdbSNP:34530959
1103+a, cdbSNP:377430758
1104+c, tdbSNP:201162801
1113+c, tdbSNP:201314348
1138+c, tdbSNP:370397099
1139+a, gdbSNP:187052457
1167+g, tdbSNP:147674187
1176+a, gdbSNP:142332940
1177+c, tdbSNP:377173120
1223+g, tdbSNP:374802139
1227+c, tdbSNP:146914548
1244+c, tdbSNP:377398446
1273+g, tdbSNP:139345451
1283+a, tdbSNP:368144580
1337+a, gdbSNP:149404575
1361+a, gdbSNP:368725038
1400+a, gdbSNP:200242092
1413+a, gdbSNP:143741446
1423+c, tdbSNP:148011436
1436+a, tdbSNP:115106223
1442+a, gdbSNP:373436697
1456+a, tdbSNP:372278080
1480+c, tdbSNP:201706887
1500+a, gdbSNP:35200917
1509+c, gdbSNP:139830947
1512+c, gdbSNP:141521378
1524+a, gdbSNP:146287469
1535+a, gdbSNP:199695397
1552+g, tdbSNP:201390204
1562+a, gdbSNP:139362297
1576+a, tdbSNP:369788899
1609+c, tdbSNP:149934081
1629+a, gdbSNP:144983345
1631+a, tdbSNP:183111131
1643+a, tdbSNP:148658183
1664+a, gdbSNP:74153522
1675+a, tdbSNP:144930144
1676+a, cdbSNP:371438908
1715+c, gdbSNP:374730217
1725+a, tdbSNP:147690385
1742+c, tdbSNP:369451185
1747+c, g, tdbSNP:187795607
1752+c, tdbSNP:200789402
1780+c, tdbSNP:377362657
1808+a, gdbSNP:369504502
1813+c, tdbSNP:142377469
1814+a, cdbSNP:74153524
1814+g, tdbSNP:386454108
1839+a, cdbSNP:199945129
1842+c, tdbSNP:147959217
complement(1859)-c, adbSNP:76898723
1861+a, gdbSNP:140585440
1863+a, gdbSNP:77532805
1893+a, gdbSNP:371232521
complement(1899)-t, gdbSNP:34494334
1912+a, gdbSNP:145569032
1914+a, cdbSNP:138288770
1922+c, gdbSNP:148867373
1922+c, gdbSNP:386474799
1931+a, gdbSNP:35122894
1992+a, gdbSNP:11189513
1992+c, tdbSNP:386517431
1997+c, gdbSNP:200555053
1998+a, cdbSNP:370785776
2010+c, tdbSNP:202079641
2011+c, gdbSNP:143613731
2012+a, gdbSNP:141538234
2074+a, gdbSNP:115833071
2156+dbSNP:
2156+a, gdbSNP:372537553
2168+a, gdbSNP:201230928
2210..2211+, cdbSNP:34484269
2212+a, gdbSNP:374256383
complement(2220)-t, cdbSNP:1952061
2220+c, tdbSNP:386550231
2224+c, tdbSNP:141801351
2231+c, tdbSNP:150584310
2238+c, gdbSNP:200672057
2258+dbSNP:
2258+a, gdbSNP:369147340
2300+c, tdbSNP:188390947
2321+a, gdbSNP:146183507
2337+dbSNP:
2337+c, tdbSNP:143935716
2374+c, gdbSNP:377074784
2390+a, gdbSNP:369929312
2393+a, cdbSNP:35145638
2417+a, tdbSNP:374326200
2448+dbSNP:
2448+a, gdbSNP:201839212
2463+a, cdbSNP:370436804
2470+a, cdbSNP:142916397
complement(2494)-g, adbSNP:11544305
2524+c, tdbSNP:144632612
2525+a, c, gdbSNP:115268639
2529+a, gdbSNP:151127984
2551+g, tdbSNP:182012480
2573+dbSNP:
2573+c, tdbSNP:374287974
2591+c, tdbSNP:200017417
2592+a, gdbSNP:148923672
2632+a, gdbSNP:371067290
2680+a, gdbSNP:201370619
2715+a, gdbSNP:375034314
2733+a, gdbSNP:113775252
2755+a, gdbSNP:150048180
2833+a, gdbSNP:74874612
2880+a, gdbSNP:370285934
2939+, cdbSNP:141033307
2950+a, cdbSNP:367821113
2991+a, gdbSNP:113130891
3067..3068+, ggdbSNP:376707113
3077+a, gdbSNP:1048754
3109+a, gdbSNP:376798910
3141+c, tdbSNP:200738235
3158+c, gdbSNP:1048757
3200+a, gdbSNP:373032495
3232+c, tdbSNP:368609308
3253+g, tdbSNP:112832441
Gene SymbolR3HCC1L
Gene SynonymC10orf28; GIDRP86; GIDRP88; PSORT
Chromosome10
Locus Map10q24.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001256620 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 3, mRNA. On-demand $899.00 20
NM_001256619 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 1, mRNA. On-demand $899.00 20
NM_014472 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA. On-demand $899.00 20
NM_001256621 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 5, mRNA. On-demand $399.00 14
NM_138469 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 2, mRNA. On-demand $899.00 20
XM_006717768 PREDICTED: Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant X1, mRNA. On-demand $899.00 20
XM_006717769 PREDICTED: Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant X2, mRNA. On-demand $899.00 20
Title A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease .
Author Grupe A, Li Y, Rowland C, Nowotny P, Hinrichs AL, Smemo S, Kauwe JS, Maxwell TJ, Cherny S, Doil L, Tacey K, van Luchene R, Myers A, Wavrant-De Vrieze F, Kaleem M, Hollingworth P, Jehu L, Foy C, Archer N, Hamilton G, Holmans P, Morris CM, Catanese J, Sninsky J, White TJ, Powell J, Hardy J, O'Donovan M, Lovestone S, Jones L, Morris JC, Thal L, Owen M, Williams J and Goate A.
Journal Am. J. Hum. Genet. 78 (1), 78-88 (2006)
Title The DNA sequence and comparative analysis of human chromosome 10 .
Author Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR and Rogers J.
Journal Nature 429 (6990), 375-381 (2004)
Title The development of a genetic profile of placental gene expression during the first trimester of pregnancy: a potential tool for identifying novel secreted markers .
Author Page N, Butlin D, Manyonda I and Lowry P.
Journal Fetal. Diagn. Ther. 15 (4), 237-245 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.