• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA.


RefSeq Accession Definition Services Price Order
NM_014472 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA. ORF Sequence $677.73
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_014472.4, 140560993
Length 3386 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA.
Product R3H and coiled-coil domain-containing protein 1-like isoform 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA114618.1, BC099848.1, AL139241.11 and BU678731.1. On Apr 4, 2007 this sequence version replaced gi:50593521.


Transcript Variant: This variant (4) differs in the 5' UTR and lacks an exon in the coding region, but maintains the reading frame, compared to variant 1. Variants 2, 3 and 4 encode the same isoform (2), which is shorter than isoform 1.


##Evidence-Data-START## Transcript exon combination :: BC099848.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055287.4
CDS 296..2632
Misc Feature(1)257..259
Misc Feature(2)257..259
Misc Feature(3)2183..2377
Misc Feature(4)2183..2377
Misc Feature(5)order(2210..2212,2216..2224,2279..2281,2285..2290)
Exon (1)1..83
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (2)84..176
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (3)177..281
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (4)282..2080
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (5)2081..2256
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (6)2257..2327
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (7)2328..2423
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (8)2424..2564
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Exon (9)2565..3371
Gene:R3HCC1L
Gene Synonym:C10orf28; GIDRP86; GIDRP88; PSORT
Translation MQQESERCRVRARRPDMALYVPKARRGAVLLKTGDEEESCGSPNSVVKEKQKESSLSQKE VFKDKPEARRLNINPDRKEHNCREEKKSSTKLRMDTCLQKTNRVCSKRGTTESKEVLSQG QQQGAPNAGVITNAPLQRHFKPKKVECLEVETTDVTGHERILLSQACLEISEAQVPSKPF QNVEFCDFSRHEPDGEAFEDKDLEGRIETDTKVLEILYEFPRVFSSVMKPENMIVPIKLS SDSEIVQQSMQTSDGILNPSSGGITTTSVPGSPDGVFDQTCVDFEVESVGGIANSTGFIL DQKDTDSIPATMGHISLSESTNDTVSPVMIRECEKNDSTADELHVKHEPPDTAVLAHETH RDSGFKNVGDITNKACMMDTTGMSCSDHVTVDSPYVVAVRIADETSINTRSFSKFVGMSA DATPLHVARSGNDTEDFSNPSACSDIYGESISSHFTESTGKLIESLSDCASSLPIKKIAG SNYNTFLDSELSMLNGTKVLSDSAVGIDLGSTGDTTEALHELRTAEEFKTEEQDDSGSIE FGVSFPDRESSSMETSIEPKATETSHTEGITAIEESWESMFNDDGDCLDPRLLQELSGNT KSRESIQEPRSDYYNHEVPDIDLSDCEFPHVIEIYDFPQEFRTEDLLRVFCSYQKKGFDI KWVDDTHALGVFSSPITARDALGIKHTMVKIRPLSQATRAAKAKARAYAEFLQPAKERPE TSAALARRLVISALGVRSKQSKTEREAELKKLQEARERKRLEAKQREDIWEGRDQSTV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1675+a, tdbSNP:144930144
Gene SymbolR3HCC1L
Gene SynonymC10orf28; GIDRP86; GIDRP88; PSORT
Chromosome10
Locus Map10q24.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001256619 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 1, mRNA. Full Length $1219.05
ORF Sequence $689.91
NM_001256620 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 3, mRNA. Full Length $1186.50
ORF Sequence $677.73
NM_001256621 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 5, mRNA. Full Length $460.23
ORF Sequence $160.95
NM_014472 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 4, mRNA. Full Length $1185.10
ORF Sequence $677.73
NM_138469 Homo sapiens R3H domain and coiled-coil containing 1-like (R3HCC1L), transcript variant 2, mRNA. Full Length $1219.05
ORF Sequence $677.73
Title A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease .
Author Grupe,A., Li,Y., Rowland,C., Nowotny,P., Hinrichs,A.L., Smemo,S., Kauwe,J.S., Maxwell,T.J., Cherny,S., Doil,L., Tacey,K., van Luchene,R., Myers,A., Wavrant-De Vrieze,F., Kaleem,M., Hollingworth,P., Jehu,L., Foy,C., Archer,N., Hamilton,G., Holmans,P., Morris,C.M., Catanese,J., Sninsky,J., White,T.J., Powell,J., Hardy,J., O'Donovan,M., Lovestone,S., Jones,L., Morris,J.C., Thal,L., Owen,M., Williams,J. and Goate,A.
Journal Am. J. Hum. Genet. 78 (1), 78-88 (2006)
Title The DNA sequence and comparative analysis of human chromosome 10 .
Author Deloukas,P., Earthrowl,M.E., Grafham,D.V., Rubenfield,M., French,L., Steward,C.A., Sims,S.K., Jones,M.C., Searle,S., Scott,C., Howe,K., Hunt,S.E., Andrews,T.D., Gilbert,J.G., Swarbreck,D., Ashurst,J.L., Taylor,A., Battles,J., Bird,C.P., Ainscough,R., Almeida,J.P., Ashwell,R.I., Ambrose,K.D., Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Bates,K., Beasley,H., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Cahill,P., Camire,D., Carter,N.P., Chapman,J.C., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Corby,N., Coulson,A., Dhami,P., Dutta,I., Dunn,M., Faulkner,L., Frankish,A., Frankland,J.A., Garner,P., Garnett,J., Gribble,S., Griffiths,C., Grocock,R., Gustafson,E., Hammond,S., Harley,J.L., Hart,E., Heath,P.D., Ho,T.P., Hopkins,B., Horne,J., Howden,P.J., Huckle,E., Hynds,C., Johnson,C., Johnson,D., Kana,A., Kay,M., Kimberley,A.M., Kershaw,J.K., Kokkinaki,M., Laird,G.K., Lawlor,S., Lee,H.M., Leongamornlert,D.A., Laird,G., Lloyd,C., Lloyd,D.M., Loveland,J., Lovell,J., McLaren,S., McLay,K.E., McMurray,A., Mashreghi-Mohammadi,M., Matthews,L., Milne,S., Nickerson,T., Nguyen,M., Overton-Larty,E., Palmer,S.A., Pearce,A.V., Peck,A.I., Pelan,S., Phillimore,B., Porter,K., Rice,C.M., Rogosin,A., Ross,M.T., Sarafidou,T., Sehra,H.K., Shownkeen,R., Skuce,C.D., Smith,M., Standring,L., Sycamore,N., Tester,J., Thorpe,A., Torcasso,W., Tracey,A., Tromans,A., Tsolas,J., Wall,M., Walsh,J., Wang,H., Weinstock,K., West,A.P., Willey,D.L., Whitehead,S.L., Wilming,L., Wray,P.W., Young,L., Chen,Y., Lovering,R.C., Moschonas,N.K., Siebert,R., Fechtel,K., Bentley,D., Durbin,R., Hubbard,T., Doucette-Stamm,L., Beck,S., Smith,D.R. and Rogers,J.
Journal Nature 429 (6990), 375-381 (2004)
Title The development of a genetic profile of placental gene expression during the first trimester of pregnancy: a potential tool for identifying novel secreted markers .
Author Page,N., Butlin,D., Manyonda,I. and Lowry,P.
Journal Fetal. Diagn. Ther. 15 (4), 237-245 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878