Sequence in raw or FASTA format:
Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 1, mRNA.
| RefSeq Version | NM_014489.2, 224465188 |
| Length | 2056 bp |
| Structure | linear |
| Update Date | 09-FEB-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 1, mRNA. |
| Product | post-GPI attachment to proteins factor 2 isoform 1 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CB988453.1, AF159615.1 and BC009930.2. On Mar 3, 2009 this sequence version replaced gi:7657101. Transcript Variant: This variant (1) is predicted to encode a longer protein (isoform 1). |
| RefSeq | NP_055304.1 |
| CDS | 127..1074 | Exon (1) | 1..116 | Exon (2) | 1..116 | Exon (3) | 117..291 | Exon (4) | 292..474 | Exon (5) | 475..727 | Exon (6) | 728..834 | Exon (7) | 835..943 | Exon (8) | 944..1968 |
| Translation | MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGATPCR
MFSAASQPLDPDGTLFRLRFTAMVWWAITFPVFGFFFCIIWSLVFHFEYTVATDCGVPNY
LPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGL
NVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKS
YSWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFG
NKELLITSQPEEKRF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 97 | + | c, g | dbSNP:61896956 |
| 308 | + | c, t | dbSNP:34117886 |
| 405 | + | c, t | dbSNP:75812077 |
| 518 | + | a, g | dbSNP:117872110 |
| 520 | + | g, t | dbSNP:61899367 |
| 838 | + | c, t | dbSNP:117338939 |
| 1182 | + | g, t | dbSNP:1055628 |
| complement(1239..1241) | - | , gag | dbSNP:3217617 |
| 1241 | + | c, t | dbSNP:115305174 |
| 1242 | + | , ctc | dbSNP:61027188 |
| 1339..1340 | + | , a | dbSNP:35179044 |
| 1350..1351 | + | , a | dbSNP:71466128 |
| 1469 | + | g, t | dbSNP:76317697 |
| 1485 | + | c, t | dbSNP:113873429 |
| 1499 | + | g, t | dbSNP:77367457 |
| complement(1617) | - | t, g | dbSNP:15792 |
| 1647 | + | c, t | dbSNP:1055639 |
| 1679 | + | a, g | dbSNP:1055640 |
| 1746 | + | c, t | dbSNP:116386717 |
| complement(1816) | - | g, a | dbSNP:15820 |
| 1937 | + | c, t | dbSNP:78433723 |
| Gene Symbol | PGAP2 |
| Gene Synonym | CWH43-N; FLJ26520; FRAG1; MGC799 |
| Chromosome | 11 |
| Locus Map | 11p15.5 |
| All Transcripts | NM_014489 , NM_001145438 |
| Title | PGAP2 is essential for correct processing and stable expression of GPI-anchored proteins . |
| Author | Tashima,Y., Taguchi,R., Murata,C., Ashida,H., Kinoshita,T. and Maeda,Y. |
| Journal | Mol. Biol. Cell 17 (3), 1410-1420 (2006) |
| Title | Human FRAG1 encodes a novel membrane-spanning protein that localizes to chromosome 11p15.5, a region of frequent loss of heterozygosity in cancer . |
| Author | Lorenzi,M.V., Castagnino,P., Aaronson,D.C., Lieb,D.C., Lee,C.C., Keck,C.L., Popescu,N.C. and Miki,T. |
| Journal | Genomics 62 (1), 59-66 (1999) |
| Title | Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening . |
| Author | Robertson,N.G., Khetarpal,U., Gutierrez-Espeleta,G.A., Bieber,F.R. and Morton,C.C. |
| Journal | Genomics 23 (1), 42-50 (1994) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |