• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_014489 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 1, mRNA. ORF Sequence $274.92
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_014489.3, 371940848
Length 2001 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 1, mRNA.
Product post-GPI attachment to proteins factor 2 isoform 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CB988453.1, AF159615.1 and AL096753.1. On Jan 12, 2012 this sequence version replaced gi:224465188.


Transcript Variant: This variant (1) encodes isoform 1.


##Evidence-Data-START## Transcript exon combination :: AF159615.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025092 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055304.1
CDS 127..1074
Misc Feature(1)196..258
Misc Feature(2)196..258
Misc Feature(3)361..1032
Misc Feature(4)379..441
Misc Feature(5)652..714
Misc Feature(6)739..801
Misc Feature(7)865..927
Misc Feature(8)937..999
Exon (1)1..116
Gene:PGAP2
Gene Synonym:CWH43-N; FRAG1
Exon (2)117..291
Gene:PGAP2
Gene Synonym:CWH43-N; FRAG1
Exon (3)292..474
Gene:PGAP2
Gene Synonym:CWH43-N; FRAG1
Exon (4)475..727
Gene:PGAP2
Gene Synonym:CWH43-N; FRAG1
Exon (5)728..834
Gene:PGAP2
Gene Synonym:CWH43-N; FRAG1
Exon (6)835..943
Gene:PGAP2
Gene Synonym:CWH43-N; FRAG1
Exon (7)944..1987
Gene:PGAP2
Gene Synonym:CWH43-N; FRAG1
Translation MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGATPCR MFSAASQPLDPDGTLFRLRFTAMVWWAITFPVFGFFFCIIWSLVFHFEYTVATDCGVPNY LPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGL NVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKS YSWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFG NKELLITSQPEEKRF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
18+dbSNP:
18+c, tdbSNP:186702137
43+c, gdbSNP:191164612
97+c, gdbSNP:61896956
142+c, tdbSNP:201106251
145+c, tdbSNP:201888053
154+c, tdbSNP:181958368
156+g, tdbSNP:139604328
173+a, gdbSNP:144780584
178+c, tdbSNP:200164387
205+a, gdbSNP:151300350
220+g, tdbSNP:140588348
255+a, cdbSNP:150486631
308+dbSNP:
308+c, tdbSNP:34117886
314+c, tdbSNP:141195165
334+c, gdbSNP:145026023
340+c, gdbSNP:138861663
361+c, tdbSNP:138755774
405+c, tdbSNP:75812077
428+g, tdbSNP:202124578
456+a, gdbSNP:201474442
511+dbSNP:
511+a, gdbSNP:200492831
520+g, tdbSNP:61899367
530+a, gdbSNP:142043517
547+a, tdbSNP:143536266
583+a, gdbSNP:148038526
607+c, tdbSNP:141753374
624+a, gdbSNP:199825792
635+a, gdbSNP:185342002
650+a, gdbSNP:150583814
661+a, gdbSNP:201471637
670+a, gdbSNP:146962851
687+a, gdbSNP:200911064
701+c, tdbSNP:142694334
735+dbSNP:
735+c, tdbSNP:147354096
736+a, gdbSNP:139509051
767+a, cdbSNP:145152257
802+a, cdbSNP:144767060
838+dbSNP:
838+c, tdbSNP:117338939
851+c, gdbSNP:148137953
876+c, tdbSNP:142937268
1038+dbSNP:
1038+c, gdbSNP:151115501
1084+a, tdbSNP:200081631
1182+g, tdbSNP:1055628
1238..1239+, tcdbSNP:201829433
1239..1241+, gagdbSNP:3217617
1239+, ctcdbSNP:61027188
1243..1245+, tctdbSNP:201013190
1339..1340+, adbSNP:35179044
1340..1341+, adbSNP:71466128
1467+c, tdbSNP:182749882
1469+g, tdbSNP:76317697
1485+c, tdbSNP:113873429
1499+g, tdbSNP:77367457
1548+c, gdbSNP:191725372
1576+c, tdbSNP:138826089
1617+g, tdbSNP:15792
1647+c, tdbSNP:1055639
1648+a, gdbSNP:183631254
1679+a, gdbSNP:1055640
1700+a, gdbSNP:188963246
1702+c, tdbSNP:192311078
1746+c, tdbSNP:116386717
1816+a, gdbSNP:15820
1937+c, tdbSNP:78433723
1951..1952+, tdbSNP:202227330
Gene SymbolPGAP2
Gene SynonymCWH43-N; FRAG1
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001145438 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 2, mRNA. Full Length $544.04
ORF Sequence $267.96
NM_001256235 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 4, mRNA. Full Length $530.41
ORF Sequence $237.51
NM_001256236 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 5, mRNA. Full Length $600.59
ORF Sequence $324.51
NM_001256237 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 9, mRNA. Full Length $570.43
ORF Sequence $254.04
NM_001256238 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 10, mRNA. Full Length $543.75
ORF Sequence $202.71
NM_001256239 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 11, mRNA. Full Length $523.74
ORF Sequence $218.37
NM_001256240 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 12, mRNA. Full Length $527.22
ORF Sequence $221.85
NM_014489 Homo sapiens post-GPI attachment to proteins 2 (PGAP2), transcript variant 1, mRNA. Full Length $580.29
ORF Sequence $274.92
Title PGAP2 is essential for correct processing and stable expression of GPI-anchored proteins .
Author Tashima,Y., Taguchi,R., Murata,C., Ashida,H., Kinoshita,T. and Maeda,Y.
Journal Mol. Biol. Cell 17 (3), 1410-1420 (2006)
Title Human FRAG1 encodes a novel membrane-spanning protein that localizes to chromosome 11p15.5, a region of frequent loss of heterozygosity in cancer .
Author Lorenzi,M.V., Castagnino,P., Aaronson,D.C., Lieb,D.C., Lee,C.C., Keck,C.L., Popescu,N.C. and Miki,T.
Journal Genomics 62 (1), 59-66 (1999)
Title Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening .
Author Robertson,N.G., Khetarpal,U., Gutierrez-Espeleta,G.A., Bieber,F.R. and Morton,C.C.
Journal Genomics 23 (1), 42-50 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878