• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hes-related family bHLH transcription factor with YRPW motif-like (HEYL), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014571 Homo sapiens hes-related family bHLH transcription factor with YRPW motif-like (HEYL), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_014571.3, 105990530
Length 4131 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens hes-related family bHLH transcription factor with YRPW motif-like (HEYL), mRNA.
Product hairy/enhancer-of-split related with YRPW motif-like protein
Comment

Summary: This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].

RefSeq NP_055386.1
CDS 52..1038
Misc Feature(1)175..384
Misc Feature(2)175..384
Misc Feature(3)181..351
Misc Feature(4)order(181..186,202..210,214..216,292..294,301..303)
Misc Feature(5)205..207
Misc Feature(6)order(223..228,235..240,244..249,304..306,313..315,
Misc Feature(7)394..537
Exon (1)1..131
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (2)132..198
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (3)199..282
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (4)283..364
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (5)365..4114
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Translation MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRIN SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFF HSCPGLPALSNQLAILGRVPSPVLPGVSSPAYPIPALRTAPLRRATGIILPARRNVLPSR GASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSAAYVAVPTPNS SSPGPAGRPAGAMLYHSWVSEITEIGAF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-t, cdbSNP:201783171
complement(64)-t, cdbSNP:200352226
complement(70)-t, gdbSNP:373227169
complement(106)-t, cdbSNP:370029829
complement(129)-t, cdbSNP:139547686
complement(139)-dbSNP:
complement(139)-t, cdbSNP:368236989
complement(157)-g, cdbSNP:181674145
191+a, gdbSNP:784625
complement(201)-dbSNP:
complement(201)-t, gdbSNP:201520391
complement(211)-g, adbSNP:139605272
complement(217)-g, adbSNP:139786829
complement(224)-t, cdbSNP:141413445
complement(254)-t, cdbSNP:143373894
complement(323)-dbSNP:
complement(323)-g, adbSNP:200560318
complement(327)-t, cdbSNP:138290900
complement(353)-g, adbSNP:376207364
complement(354)-c, adbSNP:372879677
complement(355)-c, adbSNP:375912663
complement(356)-t, cdbSNP:138456992
400+dbSNP:
400+c, tdbSNP:34926922
complement(401)-t, cdbSNP:141784681
complement(433)-t, cdbSNP:140082325
complement(444)-g, adbSNP:369111124
complement(463)-g, adbSNP:377284150
complement(487)-g, adbSNP:199883985
complement(488)-c, adbSNP:367972512
complement(502)-g, adbSNP:79211072
complement(510)-g, cdbSNP:151145306
complement(519)-g, adbSNP:41264505
complement(520)-t, cdbSNP:139355861
complement(523)-t, cdbSNP:187780653
complement(524)-g, adbSNP:149801578
complement(525)-g, adbSNP:372712511
complement(539)-g, adbSNP:139668981
complement(540)-t, cdbSNP:371911261
complement(545)-g, adbSNP:368302386
complement(546)-t, cdbSNP:41264503
complement(568)-g, adbSNP:143476012
complement(580)-c, adbSNP:375464241
complement(582)-c, adbSNP:138365730
complement(585)-g, adbSNP:113617017
complement(586)-t, cdbSNP:1180318
complement(614)-g, adbSNP:140829574
complement(625)-g, adbSNP:267598593
complement(636)-g, cdbSNP:146516387
complement(645)-t, adbSNP:374656603
complement(646)-g, cdbSNP:370285415
complement(663)-g, adbSNP:115716116
complement(666)-g, adbSNP:371317210
complement(667)-c, adbSNP:115068989
complement(682)-t, cdbSNP:199627999
complement(683)-g, cdbSNP:112803927
complement(748)-g, adbSNP:374807919
complement(749)-t, cdbSNP:372916805
complement(753)-t, cdbSNP:78932473
complement(810)-t, cdbSNP:375295630
complement(820)-g, adbSNP:372340302
complement(836)-g, adbSNP:201840029
complement(845)-t, cdbSNP:200662775
complement(850)-g, cdbSNP:1737738
complement(851)-g, cdbSNP:1737737
complement(866)-g, adbSNP:370502372
complement(876)-g, adbSNP:267598592
complement(891)-g, cdbSNP:200236163
complement(917)-g, adbSNP:201157311
complement(930)-t, cdbSNP:201707555
complement(934..935)-, cdbSNP:368717907
complement(944)-g, cdbSNP:377079448
complement(980)-g, cdbSNP:199521829
complement(990)-t, cdbSNP:139544750
complement(1020)-c, adbSNP:371583375
complement(1051)-g, adbSNP:183890301
complement(1054)-g, adbSNP:191371215
complement(1062)-g, adbSNP:150591457
1128+a, c, gdbSNP:2695320
complement(1212)-t, adbSNP:115608339
1215+a, gdbSNP:143702140
complement(1224)-g, adbSNP:188142662
complement(1286)-t, cdbSNP:183266275
complement(1362)-g, cdbSNP:41264501
complement(1397..1402)-, accaggdbSNP:2307917
complement(1400..1405)-, ggtcctdbSNP:201450931
complement(1478)-t, cdbSNP:376779376
complement(1556)-, cdbSNP:137911802
complement(1561)-g, cdbSNP:190993934
complement(1626)-g, adbSNP:375847567
complement(1865)-t, gdbSNP:147241011
complement(1900)-t, gdbSNP:188708237
complement(1963)-t, cdbSNP:376278740
complement(2010)-g, adbSNP:143934134
complement(2030)-t, cdbSNP:148112227
complement(2098)-g, adbSNP:11206478
complement(2202)-g, adbSNP:182773043
complement(2288)-g, adbSNP:117679560
complement(2319)-c, adbSNP:12049221
complement(2379)-g, adbSNP:143683714
complement(2405)-g, cdbSNP:148982776
complement(2412)-g, cdbSNP:41264499
complement(2464)-t, cdbSNP:138871678
complement(2631)-, cdbSNP:373866514
complement(2738)-g, cdbSNP:372407957
complement(2795)-t, cdbSNP:386496358
complement(2795)-g, adbSNP:41264497
complement(2857)-t, cdbSNP:190986521
complement(3043)-t, cdbSNP:186178580
complement(3144)-t, cdbSNP:375034027
complement(3165)-g, adbSNP:11554176
complement(3174)-c, adbSNP:41264495
complement(3218)-g, adbSNP:41264493
complement(3225)-g, adbSNP:41264491
complement(3242)-g, cdbSNP:375071116
complement(3272)-t, cdbSNP:6587
complement(3355)-g, adbSNP:78706896
complement(3446)-c, adbSNP:180995630
complement(3547)-g, cdbSNP:140314362
complement(3622)-t, cdbSNP:12030495
3654+c, tdbSNP:2695321
complement(3673)-g, adbSNP:200913639
complement(3727)-g, adbSNP:151170453
complement(3758)-g, cdbSNP:142093126
complement(3792)-t, gdbSNP:116401702
complement(3809)-t, gdbSNP:114297514
complement(3847)-t, gdbSNP:12022423
complement(3861)-t, cdbSNP:372439881
complement(4062)-t, cdbSNP:189693750
Gene SymbolHEYL
Gene SynonymbHLHb33; HESR3; HEY3; HRT3
Chromosome1
Locus Map1p34.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014571 Homo sapiens hes-related family bHLH transcription factor with YRPW motif-like (HEYL), mRNA. In-stock $418.00 $369.00 10
XM_005270745 PREDICTED: Homo sapiens hes-related family bHLH transcription factor with YRPW motif-like (HEYL), transcript variant X1, mRNA. On-demand $449.00 14
Title Seventy-five genetic loci influencing the human red blood cell .
Author van der Harst P, Zhang W, Mateo Leach I, Rendon A, Verweij N, Sehmi J, Paul DS, Elling U, Allayee H, Li X, Radhakrishnan A, Tan ST, Voss K, Weichenberger CX, Albers CA, Al-Hussani A, Asselbergs FW, Ciullo M, Danjou F, Dina C, Esko T, Evans DM, Franke L, Gogele M, Hartiala J, Hersch M, Holm H, Hottenga JJ, Kanoni S, Kleber ME, Lagou V, Langenberg C, Lopez LM, Lyytikainen LP, Melander O, Murgia F, Nolte IM, O'Reilly PF, Padmanabhan S, Parsa A, Pirastu N, Porcu E, Portas L, Prokopenko I, Ried JS, Shin SY, Tang CS, Teumer A, Traglia M, Ulivi S, Westra HJ, Yang J, Zhao JH, Anni F, Abdellaoui A, Attwood A, Balkau B, Bandinelli S, Bastardot F, Benyamin B, Boehm BO, Cookson WO, Das D, de Bakker PI, de Boer RA, de Geus EJ, de Moor MH, Dimitriou M, Domingues FS, Doring A, Engstrom G, Eyjolfsson GI, Ferrucci L, Fischer K, Galanello R, Garner SF, Genser B, Gibson QD, Girotto G, Gudbjartsson DF, Harris SE, Hartikainen AL, Hastie CE, Hedblad B, Illig T, Jolley J, Kahonen M, Kema IP, Kemp JP, Liang L, Lloyd-Jones H, Loos RJ, Meacham S, Medland SE, Meisinger C, Memari Y, Mihailov E, Miller K, Moffatt MF, Nauck M, Novatchkova M, Nutile T, Olafsson I, Onundarson PT, Parracciani D, Penninx BW, Perseu L, Piga A, Pistis G, Pouta A, Puc U, Raitakari O, Ring SM, Robino A, Ruggiero D, Ruokonen A, Saint-Pierre A, Sala C, Salumets A, Sambrook J, Schepers H, Schmidt CO, Sillje HH, Sladek R, Smit JH, Starr JM, Stephens J, Sulem P, Tanaka T, Thorsteinsdottir U, Tragante V, van Gilst WH, van Pelt LJ, van Veldhuisen DJ, Volker U, Whitfield JB, Willemsen G, Winkelmann BR, Wirnsberger G, Algra A, Cucca F, d'Adamo AP, Danesh J, Deary IJ, Dominiczak AF, Elliott P, Fortina P, Froguel P, Gasparini P, Greinacher A, Hazen SL, Jarvelin MR, Khaw KT, Lehtimaki T, Maerz W, Martin NG, Metspalu A, Mitchell BD, Montgomery GW, Moore C, Navis G, Pirastu M, Pramstaller PP, Ramirez-Solis R, Schadt E, Scott J, Shuldiner AR, Smith GD, Smith JG, Snieder H, Sorice R, Spector TD, Stefansson K, Stumvoll M, Tang WH, Toniolo D, Tonjes A, Visscher PM, Vollenweider P, Wareham NJ, Wolffenbuttel BH, Boomsma DI, Beckmann JS, Dedoussis GV, Deloukas P, Ferreira MA, Sanna S, Uda M, Hicks AA, Penninger JM, Gieger C, Kooner JS, Ouwehand WH, Soranzo N and Chambers JC.
Journal Nature 492 (7429), 369-375 (2012)
Title Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors .
Author Lavery DN, Villaronga MA, Walker MM, Patel A, Belandia B and Bevan CL.
Journal J. Biol. Chem. 286 (20), 17796-17808 (2011)
Title Differential effects of the HESR/HEY transcription factor family on dopamine transporter reporter gene expression via variable number of tandem repeats .
Author Kanno K and Ishiura S.
Journal J. Neurosci. Res. 89 (4), 562-575 (2011)
Title Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer .
Author Katoh M and Katoh M.
Journal Int. J. Oncol. 31 (2), 461-466 (2007)
Title Hesr, a mediator of the Notch signaling, functions in heart and vessel development .
Author Kokubo H, Miyagawa-Tomita S and Johnson RL.
Journal Trends Cardiovasc. Med. 15 (5), 190-194 (2005)
Title Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling .
Author Nakagawa O, McFadden DG, Nakagawa M, Yanagisawa H, Hu T, Srivastava
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (25), 13655-13660 (2000)
Title The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function .
Author Firulli BA, Hadzic DB, McDaid JR and Firulli AB.
Journal J. Biol. Chem. 275 (43), 33567-33573 (2000)
Title Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes .
Author Maier MM and Gessler M.
Journal Biochem. Biophys. Res. Commun. 275 (2), 652-660 (2000)
Title Characterization of the human and mouse HEY1, HEY2, and HEYL genes: cloning, mapping, and mutation screening of a new bHLH gene family .
Author Steidl C, Leimeister C, Klamt B, Maier M, Nanda I, Dixon M, Clarke R, Schmid M and Gessler M.
Journal Genomics 66 (2), 195-203 (2000)
Title Hey genes: a novel subfamily of hairy- and Enhancer of split related genes specifically expressed during mouse embryogenesis .
Author Leimeister C, Externbrink A, Klamt B and Gessler M.
Journal Mech. Dev. 85 (1-2), 173-177 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.