• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hairy/enhancer-of-split related with YRPW motif-like (HEYL), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014571 Homo sapiens hairy/enhancer-of-split related with YRPW motif-like (HEYL), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_014571.3, 105990530
Length 4131 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens hairy/enhancer-of-split related with YRPW motif-like (HEYL), mRNA.
Product hairy/enhancer-of-split related with YRPW motif-like protein
Comment

Summary: This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].

RefSeq NP_055386.1
CDS 52..1038
Misc Feature(1)175..384
Misc Feature(2)175..384
Misc Feature(3)<229..351
Misc Feature(4)order(235..240,244..249,304..306,313..315,325..327,
Misc Feature(5)394..537
Exon (1)1..131
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (2)132..198
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (3)199..282
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (4)283..364
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Exon (5)365..4114
Gene:HEYL
Gene Synonym:bHLHb33; HESR3; HEY3; HRT3
Translation MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRIN SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFF HSCPGLPALSNQLAILGRVPSPVLPGVSSPAYPIPALRTAPLRRATGIILPARRNVLPSR GASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSAAYVAVPTPNS SSPGPAGRPAGAMLYHSWVSEITEIGAF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-t, cdbSNP:201783171
complement(64)-t, cdbSNP:200352226
complement(129)-t, cdbSNP:139547686
complement(157)-dbSNP:
complement(157)-g, cdbSNP:181674145
complement(191)-g, adbSNP:784625
complement(201)-dbSNP:
complement(201)-t, gdbSNP:201520391
complement(211)-g, adbSNP:139605272
complement(217)-g, adbSNP:139786829
complement(224)-t, cdbSNP:141413445
complement(254)-t, cdbSNP:143373894
complement(323)-dbSNP:
complement(323)-g, adbSNP:200560318
complement(327)-t, cdbSNP:138290900
complement(356)-t, cdbSNP:138456992
complement(400)-dbSNP:
complement(400)-t, cdbSNP:34926922
complement(401)-t, cdbSNP:141784681
complement(433)-t, cdbSNP:140082325
complement(487)-g, adbSNP:199883985
complement(502)-g, adbSNP:79211072
complement(510)-g, cdbSNP:151145306
complement(519)-g, adbSNP:41264505
complement(520)-t, cdbSNP:139355861
complement(523)-t, cdbSNP:187780653
complement(524)-g, adbSNP:149801578
complement(539)-g, adbSNP:139668981
complement(546)-t, cdbSNP:41264503
complement(550)-t, cdbSNP:143204481
complement(568)-g, adbSNP:143476012
complement(582)-c, adbSNP:138365730
complement(585)-g, adbSNP:113617017
complement(586)-t, cdbSNP:1180318
complement(614)-g, adbSNP:140829574
complement(636)-g, cdbSNP:146516387
complement(663)-g, adbSNP:115716116
complement(667)-c, adbSNP:115068989
complement(682)-t, cdbSNP:199627999
complement(683)-g, cdbSNP:112803927
complement(753)-t, cdbSNP:78932473
complement(836)-g, adbSNP:201840029
complement(845)-t, cdbSNP:200662775
complement(850)-g, cdbSNP:1737738
complement(851)-g, cdbSNP:1737737
complement(891)-g, cdbSNP:200236163
complement(917)-g, adbSNP:201157311
complement(930)-t, cdbSNP:201707555
complement(980)-g, cdbSNP:199521829
complement(990)-t, cdbSNP:139544750
complement(1005..1006)-, ccdbSNP:71719508
complement(1051)-g, adbSNP:183890301
complement(1054)-g, adbSNP:191371215
complement(1062)-g, adbSNP:150591457
complement(1128)-g, c, adbSNP:2695320
complement(1212)-t, adbSNP:115608339
complement(1215)-g, adbSNP:143702140
complement(1224)-g, adbSNP:188142662
complement(1286)-t, cdbSNP:183266275
complement(1362)-g, cdbSNP:41264501
complement(1397..1402)-, accaggdbSNP:2307917
complement(1400..1405)-, ggtcctdbSNP:201450931
complement(1556)-, cdbSNP:137911802
complement(1561)-g, cdbSNP:190993934
complement(1865)-t, gdbSNP:147241011
complement(1900)-t, gdbSNP:188708237
complement(2010)-g, adbSNP:143934134
complement(2030)-t, cdbSNP:148112227
complement(2098)-g, adbSNP:11206478
complement(2202)-g, adbSNP:182773043
complement(2288)-g, adbSNP:117679560
complement(2319)-c, adbSNP:12049221
complement(2379)-g, adbSNP:143683714
complement(2405)-g, cdbSNP:148982776
complement(2412)-g, cdbSNP:41264499
complement(2464)-t, cdbSNP:138871678
complement(2795)-g, adbSNP:41264497
complement(2857)-t, cdbSNP:190986521
complement(3043)-t, cdbSNP:186178580
complement(3165)-g, adbSNP:11554176
complement(3174)-c, adbSNP:41264495
complement(3218)-g, adbSNP:41264493
complement(3225)-g, adbSNP:41264491
complement(3272)-t, cdbSNP:6587
complement(3355)-g, adbSNP:78706896
complement(3446)-c, adbSNP:180995630
complement(3547)-g, cdbSNP:140314362
complement(3622)-t, cdbSNP:12030495
complement(3654)-t, cdbSNP:2695321
complement(3673)-g, adbSNP:200913639
complement(3727)-g, adbSNP:151170453
complement(3758)-g, cdbSNP:142093126
complement(3792)-t, gdbSNP:116401702
complement(3809)-t, gdbSNP:114297514
complement(3847)-t, gdbSNP:12022423
complement(4062)-t, cdbSNP:189693750
Gene SymbolHEYL
Gene SynonymbHLHb33; HESR3; HEY3; HRT3
Chromosome1
Locus Map1p34.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014571 Homo sapiens hairy/enhancer-of-split related with YRPW motif-like (HEYL), mRNA. In-stock $418.00 $369.00 10
Title Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors .
Author Lavery,D.N., Villaronga,M.A., Walker,M.M., Patel,A., Belandia,B. and Bevan,C.L.
Journal J. Biol. Chem. 286 (20), 17796-17808 (2011)
Title Differential effects of the HESR/HEY transcription factor family on dopamine transporter reporter gene expression via variable number of tandem repeats .
Author Kanno,K. and Ishiura,S.
Journal J. Neurosci. Res. 89 (4), 562-575 (2011)
Title Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer .
Author Katoh,M. and Katoh,M.
Journal Int. J. Oncol. 31 (2), 461-466 (2007)
Title Hesr, a mediator of the Notch signaling, functions in heart and vessel development .
Author Kokubo,H., Miyagawa-Tomita,S. and Johnson,R.L.
Journal Trends Cardiovasc. Med. 15 (5), 190-194 (2005)
Title Hairy-related transcription factors inhibit GATA-dependent cardiac gene expression through a signal-responsive mechanism .
Author Kathiriya,I.S., King,I.N., Murakami,M., Nakagawa,M., Astle,J.M., Gardner,K.A., Gerard,R.D., Olson,E.N., Srivastava,D. and Nakagawa,O.
Journal J. Biol. Chem. 279 (52), 54937-54943 (2004)
Title Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling .
Author Nakagawa,O., McFadden,D.G., Nakagawa,M., Yanagisawa,H., Hu,T., Srivastava,D. and Olson,E.N.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (25), 13655-13660 (2000)
Title The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function .
Author Firulli,B.A., Hadzic,D.B., McDaid,J.R. and Firulli,A.B.
Journal J. Biol. Chem. 275 (43), 33567-33573 (2000)
Title Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes .
Author Maier,M.M. and Gessler,M.
Journal Biochem. Biophys. Res. Commun. 275 (2), 652-660 (2000)
Title Characterization of the human and mouse HEY1, HEY2, and HEYL genes: cloning, mapping, and mutation screening of a new bHLH gene family .
Author Steidl,C., Leimeister,C., Klamt,B., Maier,M., Nanda,I., Dixon,M., Clarke,R., Schmid,M. and Gessler,M.
Journal Genomics 66 (2), 195-203 (2000)
Title Hey genes: a novel subfamily of hairy- and Enhancer of split related genes specifically expressed during mouse embryogenesis .
Author Leimeister,C., Externbrink,A., Klamt,B. and Gessler,M.
Journal Mech. Dev. 85 (1-2), 173-177 (1999)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.