• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens intraflagellar transport 140 homolog (Chlamydomonas) (IFT140), mRNA.


RefSeq Accession Definition Services Price Order
NM_014714 Homo sapiens intraflagellar transport 140 homolog (Chlamydomonas) (IFT140), mRNA. ORF Sequence $1536.15
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_014714.3, 215820638
Length 5277 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens intraflagellar transport 140 homolog (Chlamydomonas) (IFT140), mRNA.
Product intraflagellar transport protein 140 homolog
Comment

Summary: This gene encodes one of the subunits of the intraflagellar transport (IFT) complex A. Intraflagellar transport is involved in the genesis, resorption and signaling of primary cilia. The primary cilium is a microtubule-based sensory organelle at the surface of most quiescent mammalian cells, that receives signals from its environment, such as the flow of fluid, light or odors, and transduces those signals to the nucleus. Loss of the corresponding protein in mouse results in renal cystic disease. [provided by RefSeq, Jun 2012].


##Evidence-Data-START## CDS exon combination :: AB011162.1, BC035577.1 [ECO:0000331] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_055529.2
CDS 363..4751
Misc Feature(1)342..344
Misc Feature(2)342..344
Misc Feature(3)399..533
Misc Feature(4)399..533
Misc Feature(5)<423..755
Misc Feature(6)537..656
Misc Feature(7)663..782
Misc Feature(8)1149..1301
Misc Feature(9)1326..1445
Misc Feature(10)2676..2783
Misc Feature(11)2967..3074
Misc Feature(12)3078..3164
Misc Feature(13)3225..3326
Misc Feature(14)3390..3491
Misc Feature(15)3594..3695
Misc Feature(16)3729..3830
Misc Feature(17)3777..>4142
Misc Feature(18)3927..4028
Misc Feature(19)4488..4589
Misc Feature(20)4689..4691
Exon (1)1..141
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (2)142..331
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (3)332..509
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (4)510..731
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (5)732..853
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (6)854..996
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (7)997..1172
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (8)1173..1264
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (9)1265..1371
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (10)1372..1517
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (11)1518..1721
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (12)1722..1794
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (13)1795..1886
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (14)1887..2014
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (15)2015..2132
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (16)2133..2263
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (17)2264..2429
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (18)2430..2561
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (19)2562..2761
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (20)2762..2939
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (21)2940..3130
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (22)3131..3226
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (23)3227..3359
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (24)3360..3503
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (25)3504..3632
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (26)3633..3815
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (27)3816..4022
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (28)4023..4235
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (29)4236..4402
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (30)4403..4544
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Exon (31)4545..5268
Gene:IFT140
Gene Synonym:c305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Translation MALYYDHQIEAPDAAGSPSFISWHPVHPFLAVAYISTTSTGSVDIYLEQGECVPDTHVER PFRVASLCWHPTRLVLAVGWETGEVTVFNKQDKEQHTMPLTHTADITVLRWSPSGNCLLS GDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIFRLPPPGEDLVQLAKAAVSGDEKA LDMFNWKKSSSGSLLKMGSHEGLLFFVSLMDGTVHYVDEKGKTTQVVSADSTIQMLFYME KREALVVVTENLRLSLYTVPPEGKAEEVMKVKLSGKTGRRADIALIEGSLLVMAVGEAAL RFWDIERGENYILSPDEKFGFEKGENMNCVCYCKVKGLLAAGTDRGRVAMWRKVPDFLGS PGAEGKDRWALQTPTELQGNITQIQWGSRKNLLAVNSVISVAILSERAMSSHFHQQVAAM QVSPSLLNVCFLSTGVAHSLRTDMHISGVFATKDAVAVWNGRQVAIFELSGAAIRSAGTF LCETPVLAMHEENVYTVESNRVQVRTWQGTVKQLLLFSETEGNPCFLDICGNFLVVGTDL AHFKSFDLSRREAKAHCSCRSLAELVPGVGGIASLRCSSSGSTISILPSKADNSPDSKIC FYDVEMDTVTVFDFKTGQIDRRETLSFNEQETNKSHLFVDEGLKNYVPVNHFWDQSEPRL FVCEAVQETPRSQPQSANGQPQDGRAGPAADVLILSFFISEEHGFLLHESFPRPATSHSL LGMEVPYYYFTRKPEEADREDEVEPGCHHIPQMVSRRPLRDFVGLEDCDKATRDAMLHFS FFVTIGDMDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAE QEPELEARVAVLATQLGMLEDAEQLYRKCKRHDLLNKFYQAAGRWQEALQVAEHHDRVHL RSTYHRYAGHLEASADCSRALSYYEKSDTHRFEVPRMLSEDLPSLELYVNKMKDKTLWRW WAQYLESQGEMDAALHYYELARDHFSLVRIHCFQGNVQKAAQIANETGNLAASYHLARQY ESQEEVGQAVHFYTRAQAFKNAIRLCKENGLDDQLMNLALLSSPEDMIEAARYYEEKGVQ MDRAVMLYHKAGHFSKALELAFATQQFVALQLIAEDLDETSDPALLARCSDFFIEHSQYE RAVELLLAARKYQEALQLCLGQNMSITEEMAEKMTVAKDSSDLPEESRRELLEQIADCCM RQGSYHLATKKYTQAGNKLKAMRALLKSGDTEKITFFASVSRQKEIYIMAANYLQSLDWR KEPEIMKNIIGFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLAKAKAK SPLDQETRLAQLQSRMALVKRFIQARRTYTEDPKESIKQCELLLEEPDLDSTIRIGDVYG FLVEHYVRKEEYQTAYRFLEEMRRRLPLANMSYYVSPQAVDAVHRGLGLPLPRTVPEQVR HNSMEDARELDEEVVEEADDDP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(287)-dbSNP:
complement(287)-g, adbSNP:183238098
complement(346)-g, cdbSNP:1894649
complement(359)-g, adbSNP:140403660
complement(364)-, adbSNP:33999007
complement(384)-g, cdbSNP:145267929
complement(431)-c, adbSNP:139141440
complement(489)-t, cdbSNP:150649451
complement(533)-dbSNP:
complement(533)-g, adbSNP:141882340
complement(541)-t, cdbSNP:148093208
complement(552)-g, cdbSNP:146293046
complement(556)-g, adbSNP:142257947
complement(560..561)-, gdbSNP:34468270
complement(563)-c, adbSNP:138991209
complement(572)-g, adbSNP:145160997
complement(579)-g, adbSNP:201990219
complement(580)-t, cdbSNP:149202904
complement(635..636)-, cdbSNP:34305556
complement(652)-g, adbSNP:199532257
complement(674)-g, c, adbSNP:138263672
complement(684)-t, cdbSNP:146128830
complement(690)-t, g, adbSNP:140159548
complement(714)-g, adbSNP:201381885
complement(750)-dbSNP:
complement(750)-g, adbSNP:147773934
complement(772)-t, cdbSNP:145718272
complement(803)-t, c, adbSNP:62040002
complement(821)-c, adbSNP:61739554
complement(836)-c, adbSNP:145287241
complement(839)-g, adbSNP:201338414
complement(843)-g, adbSNP:148462329
complement(844)-g, adbSNP:191927317
complement(856)-dbSNP:
complement(856)-c, adbSNP:35588860
complement(870)-t, cdbSNP:145551546
complement(888)-t, cdbSNP:201849591
complement(908)-g, adbSNP:150014480
complement(923)-c, adbSNP:139286030
complement(969)-t, gdbSNP:145788654
complement(987)-g, cdbSNP:199553087
complement(995)-g, adbSNP:201319525
complement(996)-t, cdbSNP:201188361
complement(1000)-dbSNP:
complement(1000)-g, cdbSNP:146302646
complement(1058)-t, cdbSNP:144087201
complement(1070)-t, cdbSNP:200076064
complement(1080)-t, cdbSNP:200556624
complement(1082)-c, adbSNP:201765963
complement(1120)-t, cdbSNP:141993139
complement(1134)-t, adbSNP:141254616
complement(1135)-g, adbSNP:140020318
complement(1184)-dbSNP:
complement(1184)-g, adbSNP:200604057
complement(1185)-t, cdbSNP:146163533
complement(1194)-t, cdbSNP:141986611
complement(1198)-g, cdbSNP:4786350
complement(1200)-g, adbSNP:8058674
complement(1201)-g, adbSNP:35404373
complement(1205)-t, cdbSNP:138769432
complement(1229)-g, cdbSNP:145858131
complement(1287)-dbSNP:
complement(1287)-t, cdbSNP:141993646
complement(1383)-dbSNP:
complement(1383)-t, cdbSNP:200292484
complement(1392)-t, cdbSNP:201871050
complement(1402)-t, cdbSNP:147556035
complement(1445)-g, adbSNP:143014223
complement(1446)-t, cdbSNP:182052267
complement(1488)-t, cdbSNP:200349591
complement(1508)-t, cdbSNP:200975046
complement(1536)-dbSNP:
complement(1536)-g, adbSNP:200162672
complement(1554)-t, g, c, adbSNP:34762152
complement(1582)-t, cdbSNP:151198844
complement(1592)-t, cdbSNP:199840711
complement(1604)-g, cdbSNP:142143011
complement(1666)-t, cdbSNP:201033016
complement(1672)-g, adbSNP:199881467
complement(1693)-g, adbSNP:148663745
complement(1698)-t, cdbSNP:139619013
complement(1714)-g, adbSNP:8060532
complement(1726)-dbSNP:
complement(1726)-g, adbSNP:201949058
complement(1739)-t, cdbSNP:140039128
complement(1743)-t, cdbSNP:146049665
complement(1767)-t, gdbSNP:190034269
complement(1779)-t, cdbSNP:149642543
complement(1866)-dbSNP:
complement(1866)-t, cdbSNP:183261797
complement(1871)-t, cdbSNP:139385840
complement(1880)-t, gdbSNP:199812296
complement(1903)-dbSNP:
complement(1903)-t, adbSNP:150903791
complement(1904)-t, gdbSNP:141542834
complement(1919)-t, cdbSNP:202107493
complement(1925)-t, cdbSNP:146356094
complement(1927)-t, cdbSNP:199826737
complement(1936)-g, cdbSNP:112545558
complement(1947)-t, cdbSNP:145895414
complement(1955)-c, adbSNP:143491016
complement(2029)-dbSNP:
complement(2029)-t, cdbSNP:137925718
complement(2044)-t, cdbSNP:8050974
complement(2150)-dbSNP:
complement(2150)-g, adbSNP:148904634
complement(2169)-t, cdbSNP:138674110
complement(2186)-g, adbSNP:35433680
complement(2192)-g, adbSNP:201049966
complement(2193)-g, adbSNP:35301526
complement(2199)-t, cdbSNP:200208525
complement(2223)-g, adbSNP:146480546
complement(2224)-t, cdbSNP:11648609
complement(2238)-g, adbSNP:200765913
complement(2258)-t, adbSNP:141276689
complement(2280)-dbSNP:
complement(2280)-t, cdbSNP:61742753
complement(2297)-g, adbSNP:142842389
complement(2330)-g, adbSNP:8048410
complement(2346)-t, cdbSNP:199758112
complement(2357)-g, adbSNP:200653061
complement(2370)-t, cdbSNP:34900355
complement(2371)-g, adbSNP:149845330
complement(2372)-t, cdbSNP:181881627
complement(2417)-g, adbSNP:201447957
complement(2419)-g, cdbSNP:140941344
complement(2428)-g, adbSNP:147290396
complement(2429)-t, cdbSNP:143537808
complement(2441)-dbSNP:
complement(2441)-g, cdbSNP:137966471
complement(2472)-t, cdbSNP:150745099
complement(2478)-g, adbSNP:201118178
complement(2481)-g, adbSNP:141172132
complement(2499)-g, adbSNP:148189608
complement(2500)-t, cdbSNP:200440483
complement(2536)-g, adbSNP:143200659
complement(2576)-dbSNP:
complement(2576)-g, adbSNP:141087126
complement(2600)-g, cdbSNP:138032114
complement(2609)-g, adbSNP:9930526
complement(2615)-g, adbSNP:2076436
complement(2665)-t, cdbSNP:145283562
complement(2667)-t, cdbSNP:150004786
complement(2679)-g, adbSNP:202236303
complement(2680)-t, cdbSNP:140458893
complement(2692)-t, gdbSNP:34535263
complement(2722)-t, cdbSNP:144938800
complement(2816)-dbSNP:
complement(2816)-t, cdbSNP:34668993
complement(2867)-t, cdbSNP:147300509
complement(2878)-g, adbSNP:145609033
complement(2904)-g, adbSNP:201384469
complement(2912)-g, adbSNP:2745180
complement(2923)-g, adbSNP:202189990
complement(2931)-t, cdbSNP:200876696
complement(2948)-dbSNP:
complement(2948)-g, adbSNP:148557575
complement(2960)-g, cdbSNP:144513458
complement(2981)-g, adbSNP:199762967
complement(3007)-g, adbSNP:200394007
complement(3008)-t, cdbSNP:149265820
complement(3012)-g, cdbSNP:139475088
complement(3013)-t, cdbSNP:150498538
complement(3046)-t, cdbSNP:142667516
complement(3086)-g, adbSNP:138166567
complement(3087)-t, cdbSNP:201100248
complement(3118)-t, cdbSNP:201851204
complement(3145)-dbSNP:
complement(3145)-t, adbSNP:202053259
complement(3147)-t, cdbSNP:200401891
complement(3154)-t, cdbSNP:200088700
complement(3177)-g, adbSNP:145549969
complement(3190)-g, cdbSNP:200561100
complement(3191)-t, cdbSNP:141779807
complement(3238)-dbSNP:
complement(3238)-t, cdbSNP:148240226
complement(3248)-t, cdbSNP:201150342
complement(3270)-t, cdbSNP:143720412
complement(3278)-g, adbSNP:148945612
complement(3281)-g, adbSNP:2235640
complement(3284)-t, cdbSNP:201864536
complement(3297)-t, cdbSNP:146277966
complement(3306)-g, adbSNP:142342085
complement(3327)-g, adbSNP:147756729
complement(3349)-t, cdbSNP:145645423
complement(3350)-g, adbSNP:78178397
complement(3365)-dbSNP:
complement(3365)-c, adbSNP:151293332
complement(3368)-t, cdbSNP:142122783
complement(3395)-t, cdbSNP:148625428
complement(3401)-g, adbSNP:200071245
complement(3411)-c, adbSNP:145968745
complement(3441)-t, cdbSNP:137995818
complement(3449)-t, cdbSNP:139078766
complement(3452)-t, cdbSNP:146280554
complement(3465)-g, adbSNP:141818893
complement(3466)-t, cdbSNP:138596995
complement(3509)-dbSNP:
complement(3509)-g, adbSNP:150129370
complement(3519)-t, cdbSNP:148194893
complement(3535)-g, adbSNP:141471091
complement(3571)-g, adbSNP:2235638
complement(3577)-c, adbSNP:201884886
complement(3596)-g, adbSNP:200748918
complement(3597)-t, cdbSNP:146537096
complement(3604)-g, adbSNP:142365103
complement(3745)-dbSNP:
complement(3745)-t, cdbSNP:147661907
complement(3775)-t, adbSNP:147120066
complement(3776)-t, cdbSNP:148998532
complement(3782)-t, cdbSNP:201054384
complement(3788)-t, cdbSNP:202224171
complement(3828)-dbSNP:
complement(3828)-g, adbSNP:28718802
complement(3904)-g, adbSNP:145814071
complement(3928)-t, cdbSNP:149837281
complement(3964)-t, cdbSNP:147292597
complement(4006)-g, cdbSNP:139871912
complement(4046)-dbSNP:
complement(4046)-g, adbSNP:146464282
complement(4055)-t, cdbSNP:144028766
complement(4070)-t, gdbSNP:139114618
complement(4073)-g, adbSNP:146172074
complement(4076)-t, cdbSNP:142224579
complement(4079)-g, adbSNP:148678744
complement(4080)-t, cdbSNP:114611454
complement(4081)-g, adbSNP:149521576
complement(4105)-g, adbSNP:79494390
complement(4188)-t, cdbSNP:200065348
complement(4195)-t, gdbSNP:147280047
complement(4223)-g, adbSNP:143899594
complement(4237)-dbSNP:
complement(4237)-g, adbSNP:138311751
complement(4239)-t, cdbSNP:147025984
complement(4247)-g, adbSNP:140443906
complement(4262)-g, adbSNP:148387007
complement(4274)-g, adbSNP:143385994
complement(4294)-g, adbSNP:34985348
complement(4328)-g, adbSNP:181794285
complement(4350)-t, cdbSNP:200699325
complement(4352)-t, cdbSNP:61745103
complement(4355)-g, cdbSNP:35823417
complement(4399)-t, cdbSNP:144050063
complement(4418)-dbSNP:
complement(4418)-g, adbSNP:140265753
complement(4420)-g, adbSNP:146666187
complement(4488)-t, cdbSNP:149679045
complement(4498)-t, cdbSNP:117433764
complement(4506)-g, adbSNP:139458566
complement(4520)-g, adbSNP:111494974
complement(4521)-t, cdbSNP:142668269
complement(4567)-dbSNP:
complement(4567)-g, adbSNP:202129528
complement(4570)-t, cdbSNP:113216558
complement(4571)-t, cdbSNP:147396354
complement(4589)-g, cdbSNP:143920103
complement(4622)-g, cdbSNP:200228341
complement(4625)-g, adbSNP:138436199
complement(4626)-t, cdbSNP:144726977
complement(4628)-g, adbSNP:149359139
complement(4635)-t, gdbSNP:138697817
complement(4636)-t, cdbSNP:150276786
complement(4640)-c, adbSNP:200161877
complement(4659)-g, adbSNP:141392067
complement(4660)-t, cdbSNP:138420849
complement(4665)-t, cdbSNP:145746065
complement(4668)-g, cdbSNP:140663234
complement(4671)-t, cdbSNP:201642067
complement(4681)-g, adbSNP:34813273
complement(4716)-t, cdbSNP:142106374
complement(4742)-g, adbSNP:61749517
complement(4743)-t, cdbSNP:201065562
complement(4753)-t, cdbSNP:144879630
complement(4763)-g, adbSNP:200162770
complement(4810)-t, cdbSNP:1053730
complement(4814)-t, cdbSNP:149678731
complement(4859)-t, cdbSNP:113310961
complement(4883)-g, adbSNP:112626319
complement(4986)-t, gdbSNP:184405274
complement(5154)-t, cdbSNP:143732634
complement(5180)-g, adbSNP:192256907
complement(5238)-c, adbSNP:186998817
Gene SymbolIFT140
Gene Synonymc305C8.4; c380F5.1; gs114; MZSDS; WDTC2
Chromosome16
Locus Map16p13.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_014714 Homo sapiens intraflagellar transport 140 homolog (Chlamydomonas) (IFT140), mRNA. Full Length $2374.65
ORF Sequence $1536.15
Title Mainzer-Saldino syndrome is a ciliopathy caused by IFT140 mutations .
Author Perrault,I., Saunier,S., Hanein,S., Filhol,E., Bizet,A.A., Collins,F., Salih,M.A., Gerber,S., Delphin,N., Bigot,K., Orssaud,C., Silva,E., Baudouin,V., Oud,M.M., Shannon,N., Le Merrer,M., Roche,O., Pietrement,C., Goumid,J., Baumann,C., Bole-Feysot,C., Nitschke,P., Zahrate,M., Beales,P., Arts,H.H., Munnich,A., Kaplan,J., Antignac,C., Cormier-Daire,V. and Rozet,J.M.
Journal Am. J. Hum. Genet. 90 (5), 864-870 (2012)
Title Disruption of IFT complex A causes cystic kidneys without mitotic spindle misorientation .
Author Jonassen,J.A., SanAgustin,J., Baker,S.P. and Pazour,G.J.
Journal J. Am. Soc. Nephrol. 23 (4), 641-651 (2012)
Title Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs .
Author Nakayama,M., Kikuno,R. and Ohara,O.
Journal Genome Res. 12 (11), 1773-1784 (2002)
Title Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16 .
Author Daniels,R.J., Peden,J.F., Lloyd,C., Horsley,S.W., Clark,K., Tufarelli,C., Kearney,L., Buckle,V.J., Doggett,N.A., Flint,J. and Higgs,D.R.
Journal Hum. Mol. Genet. 10 (4), 339-352 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878