• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu09660 Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu09660C Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), mRNA. Customized vector On-demand $269.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_014820.4, 354459408
Length 1827 bp
Structure linear
Update Date 12-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), mRNA.
Product mitochondrial import receptor subunit TOM70
Comment

Summary: This gene encodes an import receptor of the outer mitochondrial membrane that is part of the translocase of the outer membrane complex. This protein is involved in the import of mitochondrial precursor proteins. [provided by RefSeq, Oct 2011].

RefSeq NP_055635.3
CDS 450..2276
Misc Feature(1)399..401
Misc Feature(2)453..455
Misc Feature(3)453..455
Misc Feature(4)564..626
Misc Feature(5)570..2252
Misc Feature(6)702..704
Misc Feature(7)720..722
Misc Feature(8)720..722
Misc Feature(9)735..737
Misc Feature(10)777..779
Misc Feature(11)789..890
Misc Feature(12)792..1100
Misc Feature(13)order(792..797,801..806,813..818,918..923,927..932,
Misc Feature(14)order(810..812,846..848,858..860,867..869,927..929,
Misc Feature(15)906..1007
Misc Feature(16)1002..1004
Misc Feature(17)1329..1430
Misc Feature(18)1341..1646
Misc Feature(19)order(1341..1346,1353..1358,1446..1451,1455..1460,
Misc Feature(20)order(1350..1352,1386..1388,1398..1400,1407..1409,
Misc Feature(21)1434..1535
Misc Feature(22)1548..1649
Misc Feature(23)1551..1868
Misc Feature(24)order(1551..1556,1560..1565,1572..1577,1662..1667,
Misc Feature(25)order(1569..1571,1605..1607,1617..1619,1626..1628,
Misc Feature(26)1650..1751
Misc Feature(27)1767..1874
Misc Feature(28)1875..1976
Misc Feature(29)1896..2180
Misc Feature(30)order(1896..1898,1932..1934,1944..1946,1953..1955,
Misc Feature(31)order(1899..1904,1989..1994,1998..2003,2010..2015,
Misc Feature(32)1980..2081
Misc Feature(33)2082..2183
Exon (1)1..773
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (2)774..947
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (3)948..1074
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (4)1075..1184
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (5)1185..1333
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (6)1334..1541
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (7)1542..1676
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (8)1677..1784
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (9)1785..1901
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (10)1902..1999
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (11)2000..2122
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (12)2123..4381
Gene:TOMM70A
Gene Synonym:TOMM70A
Translation MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWS RQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNK GNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAV ELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKA KEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLK AKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKE ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYA LYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEI DNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKK YGLKPPTL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(11)-dbSNP:
complement(11)-g, adbSNP:189960378
complement(16)-g, adbSNP:143938437
complement(34)-g, cdbSNP:185950927
complement(47)-t, cdbSNP:139056478
complement(142)-g, adbSNP:182721280
complement(339)-g, cdbSNP:146188486
complement(413..414)-, cdbSNP:200473359
complement(424)-t, g, cdbSNP:6786662
complement(494)-c, adbSNP:370075553
complement(630)-t, gdbSNP:372350246
complement(632)-c, adbSNP:138465118
complement(695)-t, cdbSNP:7645509
complement(739)-c, adbSNP:138698299
complement(854)-dbSNP:
complement(854)-t, cdbSNP:369975182
complement(883)-g, adbSNP:149008143
complement(888)-t, cdbSNP:369825263
complement(900)-c, adbSNP:145907525
complement(1026)-dbSNP:
complement(1026)-g, adbSNP:9833995
complement(1037)-g, adbSNP:150940502
complement(1091)-dbSNP:
complement(1091)-g, adbSNP:146760799
complement(1092)-t, cdbSNP:371656919
complement(1146)-t, gdbSNP:139919828
complement(1189)-dbSNP:
complement(1189)-t, cdbSNP:376877331
complement(1192)-t, gdbSNP:150019765
complement(1243)-g, adbSNP:139243762
complement(1245)-t, cdbSNP:140983249
complement(1334)-dbSNP:
complement(1334)-g, adbSNP:199537963
complement(1393)-t, cdbSNP:143990355
complement(1394)-g, adbSNP:79032648
complement(1486)-t, cdbSNP:369031386
complement(1557)-dbSNP:
complement(1557)-g, cdbSNP:202011920
complement(1642)-g, adbSNP:140101095
complement(1648)-t, cdbSNP:144929730
complement(1754)-dbSNP:
complement(1754)-g, adbSNP:140995978
complement(1801)-dbSNP:
complement(1801)-t, cdbSNP:34170847
complement(1813)-t, gdbSNP:184267923
complement(1816)-g, adbSNP:374048296
complement(1868)-t, cdbSNP:370111871
complement(1877)-g, adbSNP:149760059
complement(1883)-g, adbSNP:201232223
complement(1895)-g, adbSNP:201655665
complement(1946)-dbSNP:
complement(1946)-g, adbSNP:374012718
complement(2062)-dbSNP:
complement(2062)-g, adbSNP:200108535
complement(2068)-g, adbSNP:147323693
complement(2092)-t, cdbSNP:150870478
complement(2233)-dbSNP:
complement(2233)-g, cdbSNP:182755533
2252+c, tdbSNP:277644
complement(2288)-t, cdbSNP:369942383
complement(2481)-g, cdbSNP:1561743
complement(2494..2498)-, tctaadbSNP:75267270
2545+a, tdbSNP:1045608
complement(2588)-t, adbSNP:201468460
complement(2588)-, adbSNP:11332311
complement(2627)-t, cdbSNP:189754105
2664+a, tdbSNP:1045610
2704+a, gdbSNP:1801865
complement(2707)-g, adbSNP:368789432
complement(2831)-g, adbSNP:115227601
complement(2985..2986)-, atadbSNP:377316003
2996+c, gdbSNP:145959428
complement(3002)-t, cdbSNP:74796833
complement(3039)-g, adbSNP:3772687
complement(3078)-t, cdbSNP:185834394
complement(3173)-g, cdbSNP:413425
complement(3213)-t, cdbSNP:142481837
complement(3224)-g, adbSNP:182729005
complement(3250..3251)-, atadbSNP:34505655
complement(3251..3252)-, tatdbSNP:16337
complement(3255..3256)-, tatdbSNP:201616629
complement(3387)-g, adbSNP:137975956
complement(3446)-g, adbSNP:190060512
complement(3501..3502)-, adbSNP:36115298
3608+g, tdbSNP:408090
complement(3613)-t, cdbSNP:143557481
complement(3628)-c, adbSNP:186793749
complement(3675)-t, cdbSNP:114641074
3827+c, gdbSNP:12591
complement(3827)-g, cdbSNP:111175944
complement(3967)-g, cdbSNP:3772686
complement(4020)-, cdbSNP:147205322
complement(4137)-t, cdbSNP:148888252
complement(4189)-t, cdbSNP:181812894
4272+c, gdbSNP:15266
4273+c, tdbSNP:1801864
complement(4322)-g, adbSNP:374756198
complement(4368)-g, adbSNP:371471171
Gene SymbolTOMM70A
Gene SynonymTOMM70A
Chromosome3
Locus Map3q12.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014820 Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), mRNA. On-demand TBD TBD
Title Tom70 is essential for PINK1 import into mitochondria .
Author Kato H, Lu Q, Rapaport D and Kozjak-Pavlovic V.
Journal PLoS ONE 8 (3), E58435 (2013)
Title Translocase of outer mitochondrial membrane 70 induces interferon response and is impaired by hepatitis C virus NS3 .
Author Kasama Y, Saito M, Takano T, Nishimura T, Satoh M, Wang Z, Ali SN, Harada S, Kohara M and Tsukiyama-Kohara K.
Journal Virus Res. 163 (1), 405-409 (2012)
Title Interaction between the human mitochondrial import receptors Tom20 and Tom70 in vitro suggests a chaperone displacement mechanism .
Author Fan AC, Kozlov G, Hoegl A, Marcellus RC, Wong MJ, Gehring K and Young JC.
Journal J. Biol. Chem. 286 (37), 32208-32219 (2011)
Title Stoichiometry and thermodynamics of the interaction between the C-terminus of human 90kDa heat shock protein Hsp90 and the mitochondrial translocase of outer membrane Tom70 .
Author Gava LM, Goncalves DC, Borges JC and Ramos CH.
Journal Arch. Biochem. Biophys. 513 (2), 119-125 (2011)
Title Hsp90 functions in the targeting and outer membrane translocation steps of Tom70-mediated mitochondrial import .
Author Fan AC, Bhangoo MK and Young JC.
Journal J. Biol. Chem. 281 (44), 33313-33324 (2006)
Title An internal EELD domain facilitates mitochondrial targeting of Mcl-1 via a Tom70-dependent pathway .
Author Chou CH, Lee RS and Yang-Yen HF.
Journal Mol. Biol. Cell 17 (9), 3952-3963 (2006)
Title Dissection of the mitochondrial import and assembly pathway for human Tom40 .
Author Humphries AD, Streimann IC, Stojanovski D, Johnston AJ, Yano M, Hoogenraad NJ and Ryan MT.
Journal J. Biol. Chem. 280 (12), 11535-11543 (2005)
Title Molecular chaperones Hsp90 and Hsp70 deliver preproteins to the mitochondrial import receptor Tom70 .
Author Young JC, Hoogenraad NJ and Hartl FU.
Journal Cell 112 (1), 41-50 (2003)
Title Characterization of a human import component of the mitochondrial outer membrane, TOMM70A .
Author Edmonson AM, Mayfield DK, Vervoort V, DuPont BR and Argyropoulos G.
Journal Cell Commun. Adhes. 9 (1), 15-27 (2002)
Title Identification of a mammalian homologue of the fungal Tom70 mitochondrial precursor protein import receptor as a thyroid hormone-regulated gene in specific brain regions .
Author Alvarez-Dolado M, Gonzalez-Moreno M, Valencia A, Zenke M, Bernal J and Munoz A.
Journal J. Neurochem. 73 (6), 2240-2249 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.