Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), nuclear gene encoding mitochondrial protein, mRNA.
| RefSeq Version | NM_014820.3, 54607134 |
| Length | 4376 bp |
| Structure | linear |
| Update Date | 11-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), nuclear gene encoding mitochondrial protein, mRNA. |
| Product | mitochondrial import receptor subunit TOM70 |
| Comment | Summary: The translocase of outer mitochondrial membrane (TOM) complex is a multisubunit complex involved in the recognition, unfolding, and translocation of preproteins into the mitochondria. See TIM17A (MIM 605057).[supplied by OMIM]. |
| RefSeq | NP_055635.3 |
| CDS | 433..2259 | Exon (1) | 1..756 | Exon (2) | 1..756 | Exon (3) | 757..930 | Exon (4) | 931..1057 | Exon (5) | 1058..1167 | Exon (6) | 1168..1316 | Exon (7) | 1317..1524 | Exon (8) | 1525..1659 | Exon (9) | 1660..1767 | Exon (10) | 1768..1884 | Exon (11) | 1885..1982 | Exon (12) | 1983..2105 | Exon (13) | 2106..4360 |
| Translation | MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWS
RQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNK
GNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAV
ELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKA
KEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLK
AKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKE
ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA
VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYA
LYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEI
DNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKK
YGLKPPTL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(407) | - | g, c | dbSNP:6786662 |
| complement(678) | - | t, c | dbSNP:7645509 |
| complement(1009) | - | g, a | dbSNP:9833995 |
| complement(1187) | - | t, g | dbSNP:114416163 |
| complement(1377) | - | g, a | dbSNP:79032648 |
| 1784 | + | c, t | dbSNP:34170847 |
| complement(2104) | - | , largedeletion | dbSNP:71754044 |
| 2235 | + | c, t | dbSNP:277644 |
| 2464 | + | c, g | dbSNP:1561743 |
| complement(2477..2481) | - | , tctaa | dbSNP:75267270 |
| 2528 | + | a, t | dbSNP:1045608 |
| complement(2549) | - | , t | dbSNP:72462337 |
| complement(2562) | - | , a | dbSNP:11332311 |
| complement(2570) | - | , a | dbSNP:72455252 |
| complement(2571) | - | t, a | dbSNP:75170305 |
| complement(2571) | - | , a | dbSNP:63447762 |
| 2647 | + | a, t | dbSNP:1045610 |
| 2687 | + | a, g | dbSNP:1801865 |
| complement(2814) | - | g, a | dbSNP:115227601 |
| complement(2985) | - | t, c | dbSNP:74796833 |
| complement(3022) | - | g, a | dbSNP:3772687 |
| complement(3156) | - | g, c | dbSNP:413425 |
| complement(3233..3234) | - | , ata | dbSNP:34505655 |
| 3234..3235 | + | , tat | dbSNP:16337 |
| complement(3234) | - | g, a | dbSNP:114484488 |
| complement(3235) | - | t, a | dbSNP:78847883 |
| complement(3429) | - | g, a | dbSNP:78643990 |
| complement(3484..3485) | - | , a | dbSNP:36115298 |
| 3591 | + | g, t | dbSNP:408090 |
| complement(3658) | - | t, c | dbSNP:114641074 |
| 3810 | + | c, g | dbSNP:12591 |
| complement(3950) | - | g, c | dbSNP:3772686 |
| 4255 | + | c, g | dbSNP:15266 |
| 4256 | + | c, t | dbSNP:1801864 |
| Title | Tom70 mediates activation of interferon regulatory factor 3 on mitochondria . |
| Author | Liu,X.Y., Wei,B., Shi,H.X., Shan,Y.F. and Wang,C. |
| Journal | Cell Res. 20 (9), 994-1011 (2010) |
| Title | Human mitochondrial import receptor Tom70 functions as a monomer . |
| Author | Fan,A.C., Gava,L.M., Ramos,C.H. and Young,J.C. |
| Journal | Biochem. J. 429 (3), 553-563 (2010) |
| Title | Genetic variants in nuclear-encoded mitochondrial genes influence . |
| Author | Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M., Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D., Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J. |
| Journal | PLoS ONE 5 (9), E12862 (2010) |
| Title | In vitro methylation of nuclear respiratory factor-2 binding sites suppresses the promoter activity of the human TOMM70 gene . |
| Author | Blesa,J.R., Hegde,A.A. and Hernandez-Yago,J. |
| Journal | Gene 427 (1-2), 58-64 (2008) |
| Title | Interactions of S100A2 and S100A6 with the tetratricopeptide repeat proteins, Hsp90/Hsp70-organizing protein and kinesin light chain . |
| Author | Shimamoto,S., Takata,M., Tokuda,M., Oohira,F., Tokumitsu,H. and Kobayashi,R. |
| Journal | J. Biol. Chem. 283 (42), 28246-28258 (2008) |
| Title | An internal EELD domain facilitates mitochondrial targeting of Mcl-1 via a Tom70-dependent pathway . |
| Author | Chou,C.H., Lee,R.S. and Yang-Yen,H.F. |
| Journal | Mol. Biol. Cell 17 (9), 3952-3963 (2006) |
| Title | Dissection of the mitochondrial import and assembly pathway for human Tom40 . |
| Author | Humphries,A.D., Streimann,I.C., Stojanovski,D., Johnston,A.J., Yano,M., Hoogenraad,N.J. and Ryan,M.T. |
| Journal | J. Biol. Chem. 280 (12), 11535-11543 (2005) |
| Title | Molecular chaperones Hsp90 and Hsp70 deliver preproteins to the mitochondrial import receptor Tom70 . |
| Author | Young,J.C., Hoogenraad,N.J. and Hartl,F.U. |
| Journal | Cell 112 (1), 41-50 (2003) |
| Title | Characterization of a human import component of the mitochondrial outer membrane, TOMM70A . |
| Author | Edmonson,A.M., Mayfield,D.K., Vervoort,V., DuPont,B.R. and Argyropoulos,G. |
| Journal | Cell Commun. Adhes. 9 (1), 15-27 (2002) |
| Title | Identification of a mammalian homologue of the fungal Tom70 mitochondrial precursor protein import receptor as a thyroid hormone-regulated gene in specific brain regions . |
| Author | Alvarez-Dolado,M., Gonzalez-Moreno,M., Valencia,A., Zenke,M., Bernal,J. and Munoz,A. |
| Journal | J. Neurochem. 73 (6), 2240-2249 (1999) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |