• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), nuclear gene encoding mitochondrial protein, mRNA.


RefSeq Accession Definition Services Price Order
NM_014820 Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), nuclear gene encoding mitochondrial protein, mRNA. ORF Sequence $529.83
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_014820.4, 354459408
Length 4381 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), nuclear gene encoding mitochondrial protein, mRNA.
Product mitochondrial import receptor subunit TOM70
Comment

Summary: This gene encodes an import receptor of the outer mitochondrial membrane that is part of the translocase of the outer membrane complex. This protein is involved in the import of mitochondrial precursor proteins. [provided by RefSeq, Oct 2011].

RefSeq NP_055635.3
CDS 450..2276
Misc Feature(1)399..401
Misc Feature(2)564..626
Misc Feature(3)564..626
Misc Feature(4)702..704
Misc Feature(5)720..722
Misc Feature(6)720..722
Misc Feature(7)735..737
Misc Feature(8)777..779
Misc Feature(9)783..1001
Misc Feature(10)789..890
Misc Feature(11)792..1100
Misc Feature(12)order(792..797,801..806,813..818,918..923,927..932,
Misc Feature(13)order(810..812,846..848,858..860,867..869,927..929,
Misc Feature(14)906..1007
Misc Feature(15)1002..1004
Misc Feature(16)1329..1430
Misc Feature(17)1434..1535
Misc Feature(18)1545..1745
Misc Feature(19)1548..1649
Misc Feature(20)1551..1868
Misc Feature(21)order(1551..1556,1560..1565,1572..1577,1662..1667,
Misc Feature(22)order(1569..1571,1605..1607,1617..1619,1626..1628,
Misc Feature(23)1650..1751
Misc Feature(24)1767..1874
Misc Feature(25)1869..2072
Misc Feature(26)1875..1976
Misc Feature(27)1878..2180
Misc Feature(28)order(1878..1883,1887..1892,1899..1904,1989..1994,
Misc Feature(29)order(1896..1898,1932..1934,1944..1946,1953..1955,
Misc Feature(30)1980..2081
Misc Feature(31)2082..2183
Exon (1)1..773
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (2)774..947
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (3)948..1074
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (4)1075..1184
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (5)1185..1333
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (6)1334..1541
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (7)1542..1676
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (8)1677..1784
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (9)1785..1901
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (10)1902..1999
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (11)2000..2122
Gene:TOMM70A
Gene Synonym:TOMM70A
Exon (12)2123..4381
Gene:TOMM70A
Gene Synonym:TOMM70A
Translation MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWS RQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNK GNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAV ELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKA KEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLK AKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKE ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEA VADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYA LYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEI DNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKK YGLKPPTL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(11)-dbSNP:
complement(11)-g, adbSNP:189960378
complement(16)-g, adbSNP:143938437
complement(34)-g, cdbSNP:185950927
complement(47)-t, cdbSNP:139056478
complement(142)-g, adbSNP:182721280
complement(339)-g, cdbSNP:146188486
complement(413..414)-, cdbSNP:200473359
complement(424)-t, g, cdbSNP:6786662
complement(632)-c, adbSNP:138465118
complement(695)-t, cdbSNP:7645509
complement(739)-c, adbSNP:138698299
complement(883)-dbSNP:
complement(883)-g, adbSNP:149008143
complement(900)-c, adbSNP:145907525
complement(1026)-dbSNP:
complement(1026)-g, adbSNP:9833995
complement(1037)-g, adbSNP:150940502
complement(1091)-dbSNP:
complement(1091)-g, adbSNP:146760799
complement(1146)-t, gdbSNP:139919828
complement(1192)-dbSNP:
complement(1192)-t, gdbSNP:150019765
complement(1243)-g, adbSNP:139243762
complement(1245)-t, cdbSNP:140983249
complement(1334)-dbSNP:
complement(1334)-g, adbSNP:199537963
complement(1393)-t, cdbSNP:143990355
complement(1394)-g, adbSNP:79032648
complement(1411)-g, adbSNP:149491430
complement(1557)-dbSNP:
complement(1557)-g, cdbSNP:202011920
complement(1642)-g, adbSNP:140101095
complement(1648)-t, cdbSNP:144929730
complement(1754)-dbSNP:
complement(1754)-g, adbSNP:140995978
complement(1801)-dbSNP:
complement(1801)-t, cdbSNP:34170847
complement(1813)-t, gdbSNP:184267923
complement(1877)-g, adbSNP:149760059
complement(1883)-g, adbSNP:201232223
complement(1895)-g, adbSNP:201655665
complement(2062)-dbSNP:
complement(2062)-g, adbSNP:200108535
complement(2068)-g, adbSNP:147323693
complement(2092)-t, cdbSNP:150870478
complement(2233)-dbSNP:
complement(2233)-g, cdbSNP:182755533
complement(2252)-t, cdbSNP:277644
complement(2481)-g, cdbSNP:1561743
complement(2494..2498)-, tctaadbSNP:75267270
complement(2545)-t, adbSNP:1045608
complement(2566)-, tdbSNP:72462337
complement(2588)-t, adbSNP:201468460
complement(2588)-, adbSNP:11332311
complement(2627)-t, cdbSNP:189754105
complement(2664)-t, adbSNP:1045610
complement(2704)-g, adbSNP:1801865
complement(2831)-g, adbSNP:115227601
complement(2996)-g, cdbSNP:145959428
complement(3002)-t, cdbSNP:74796833
complement(3039)-g, adbSNP:3772687
complement(3078)-t, cdbSNP:185834394
complement(3173)-g, cdbSNP:413425
complement(3213)-t, cdbSNP:142481837
complement(3224)-g, adbSNP:182729005
complement(3250..3251)-, atadbSNP:34505655
complement(3251..3252)-, tatdbSNP:16337
complement(3255..3256)-, tatdbSNP:201616629
complement(3387)-g, adbSNP:137975956
complement(3446)-g, adbSNP:190060512
complement(3504..3505)-, adbSNP:36115298
complement(3608)-t, gdbSNP:408090
complement(3613)-t, cdbSNP:143557481
complement(3628)-c, adbSNP:186793749
complement(3675)-t, cdbSNP:114641074
complement(3827)-g, cdbSNP:12591
complement(3967)-g, cdbSNP:3772686
complement(4020)-, cdbSNP:147205322
complement(4137)-t, cdbSNP:148888252
complement(4189)-t, cdbSNP:181812894
complement(4272)-g, cdbSNP:15266
complement(4273)-t, cdbSNP:1801864
Gene SymbolTOMM70A
Gene SynonymTOMM70A
Chromosome3
Locus Map3q12.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_014820 Homo sapiens translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae) (TOMM70A), nuclear gene encoding mitochondrial protein, mRNA. Full Length $1533.35
ORF Sequence $529.83
Title Translocase of outer mitochondrial membrane 70 induces interferon response and is impaired by hepatitis C virus NS3 .
Author Kasama,Y., Saito,M., Takano,T., Nishimura,T., Satoh,M., Wang,Z., Ali,S.N., Harada,S., Kohara,M. and Tsukiyama-Kohara,K.
Journal Virus Res. 163 (1), 405-409 (2012)
Title Interaction between the human mitochondrial import receptors Tom20 and Tom70 in vitro suggests a chaperone displacement mechanism .
Author Fan,A.C., Kozlov,G., Hoegl,A., Marcellus,R.C., Wong,M.J., Gehring,K. and Young,J.C.
Journal J. Biol. Chem. 286 (37), 32208-32219 (2011)
Title Stoichiometry and thermodynamics of the interaction between the C-terminus of human 90kDa heat shock protein Hsp90 and the mitochondrial translocase of outer membrane Tom70 .
Author Gava,L.M., Goncalves,D.C., Borges,J.C. and Ramos,C.H.
Journal Arch. Biochem. Biophys. 513 (2), 119-125 (2011)
Title Translocase of outer mitochondrial membrane 70 expression is induced by hepatitis C virus and is related to the apoptotic response .
Author Takano,T., Kohara,M., Kasama,Y., Nishimura,T., Saito,M., Kai,C. and Tsukiyama-Kohara,K.
Journal J. Med. Virol. 83 (5), 801-809 (2011)
Title Hsp90 functions in the targeting and outer membrane translocation steps of Tom70-mediated mitochondrial import .
Author Fan,A.C., Bhangoo,M.K. and Young,J.C.
Journal J. Biol. Chem. 281 (44), 33313-33324 (2006)
Title An internal EELD domain facilitates mitochondrial targeting of Mcl-1 via a Tom70-dependent pathway .
Author Chou,C.H., Lee,R.S. and Yang-Yen,H.F.
Journal Mol. Biol. Cell 17 (9), 3952-3963 (2006)
Title Dissection of the mitochondrial import and assembly pathway for human Tom40 .
Author Humphries,A.D., Streimann,I.C., Stojanovski,D., Johnston,A.J., Yano,M., Hoogenraad,N.J. and Ryan,M.T.
Journal J. Biol. Chem. 280 (12), 11535-11543 (2005)
Title Molecular chaperones Hsp90 and Hsp70 deliver preproteins to the mitochondrial import receptor Tom70 .
Author Young,J.C., Hoogenraad,N.J. and Hartl,F.U.
Journal Cell 112 (1), 41-50 (2003)
Title Characterization of a human import component of the mitochondrial outer membrane, TOMM70A .
Author Edmonson,A.M., Mayfield,D.K., Vervoort,V., DuPont,B.R. and Argyropoulos,G.
Journal Cell Commun. Adhes. 9 (1), 15-27 (2002)
Title Identification of a mammalian homologue of the fungal Tom70 mitochondrial precursor protein import receptor as a thyroid hormone-regulated gene in specific brain regions .
Author Alvarez-Dolado,M., Gonzalez-Moreno,M., Valencia,A., Zenke,M., Bernal,J. and Munoz,A.
Journal J. Neurochem. 73 (6), 2240-2249 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878