• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014951 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_014951.2, 148596971
Length 4223 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA.
Product protein ZNF365 isoform A
Comment

Summary: This gene encodes several isoforms which have different expression patterns and functions. Mutation in this gene is associated with uric acid nephrolithiasis (UAN). Alternatively spliced variants, encoding distinct proteins, have been identified. [provided by RefSeq, May 2010].


Transcript Variant: This variant (A) differs in the 3' coding region and UTR compared to variant C. The resulting protein (isoform A) is shorter and has a distinct C-terminus compared to isoform C.

RefSeq NP_055766.2
CDS 316..1539
Misc Feature(1)217..219
Misc Feature(2)217..219
Misc Feature(3)<787..>981
Misc Feature(4)<787..>981
Exon (1)1..302
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (2)303..1058
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (3)1059..1239
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (4)1240..1277
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (5)1278..4208
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Translation MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLT KCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAE RPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRI DKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESE EELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGF VRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPA KAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
279..281+, gcadbSNP:3830349
280..282+, cagdbSNP:71908270
291+a, gdbSNP:111930964
309+dbSNP:
309+c, tdbSNP:189552151
378+c, tdbSNP:200922294
383+a, gdbSNP:144485380
401+c, tdbSNP:191288886
435+c, gdbSNP:79142251
468+c, tdbSNP:142339866
545+a, cdbSNP:11545586
569+g, tdbSNP:145952676
680+c, tdbSNP:143972122
710+g, tdbSNP:199867564
730+c, gdbSNP:199538761
757+c, tdbSNP:183722776
758+c, tdbSNP:201364250
851+a, gdbSNP:200762856
882+g, tdbSNP:139813334
890+c, tdbSNP:142196197
908+a, gdbSNP:188391034
984+c, tdbSNP:150802191
989+c, tdbSNP:61863383
1019+a, gdbSNP:139132215
1071+dbSNP:
1071+a, gdbSNP:148035675
1084+c, tdbSNP:192211282
1123+c, tdbSNP:184098438
1219+c, tdbSNP:116297631
1230+c, tdbSNP:200153426
1239+a, gdbSNP:191326652
1292+dbSNP:
1292+c, tdbSNP:147898988
1293+a, gdbSNP:141696527
1300+g, tdbSNP:145454121
1301+c, tdbSNP:138452965
1324+g, tdbSNP:3758490
1335+c, tdbSNP:149142683
1380+c, gdbSNP:143052727
1393+a, gdbSNP:200865539
1402+a, gdbSNP:200441783
1407+c, tdbSNP:148384716
1516+a, cdbSNP:74950776
1560+c, tdbSNP:146162672
1563+c, tdbSNP:41307502
1639+c, tdbSNP:7899014
1655+a, gdbSNP:185083066
1689+a, gdbSNP:149449751
1937+c, tdbSNP:75879212
1993+a, gdbSNP:143879492
2105+c, gdbSNP:57005390
2107+c, tdbSNP:7902778
2108+a, gdbSNP:189121952
2155+a, gdbSNP:117342856
2222+a, gdbSNP:148627158
2233+c, gdbSNP:77856112
2256+c, gdbSNP:78777159
2306+a, gdbSNP:201679973
2320+c, gdbSNP:74623257
2432+a, gdbSNP:144307704
2478..2479+, ctdbSNP:143608968
2546+c, tdbSNP:76598947
2575+a, gdbSNP:200362979
2575+, gdbSNP:56738376
2595+c, tdbSNP:41304617
2610+a, gdbSNP:181846077
2626+a, gdbSNP:74156193
2814+c, tdbSNP:12773319
2845+g, tdbSNP:56117326
3047+c, tdbSNP:115008445
3188+c, tdbSNP:186294967
3236+, tdbSNP:199574900
3237+, gdbSNP:5785521
3237+g, tdbSNP:202164670
3244+g, tdbSNP:77309763
3245+a, tdbSNP:80269260
3385+a, cdbSNP:2893899
3438+a, tdbSNP:201595815
3462+a, tdbSNP:189527475
3513+g, tdbSNP:77702278
3546+c, gdbSNP:145285201
3562+a, gdbSNP:151002719
3644+c, tdbSNP:74434092
3679+c, tdbSNP:76416315
3854+c, tdbSNP:180949518
3894+c, tdbSNP:186357198
3907+g, tdbSNP:200062549
4006+c, tdbSNP:191109977
4007+a, gdbSNP:76815522
Gene SymbolZNF365
Gene SynonymSu48; UAN; ZNF365D
Chromosome10
Locus Map10q21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_014951 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA. On-demand $549.00 14
NM_199450 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant B, mRNA. On-demand $549.00 14
NM_199451 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant C, mRNA. On-demand $699.00 18
NM_199452 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant D, mRNA. On-demand $399.00 14
Title Genome-wide association study of intelligence: additive effects of novel brain expressed genes .
Author Loo,S.K., Shtir,C., Doyle,A.E., Mick,E., McGough,J.J., McCracken,J., Biederman,J., Smalley,S.L., Cantor,R.M., Faraone,S.V. and Nelson,S.F.
Journal J Am Acad Child Adolesc Psychiatry 51 (4), 432-440 (2012)
Title Common variants at the 19p13.1 and ZNF365 loci are associated with .
Author Couch,F.J., Gaudet,M.M., Antoniou,A.C., Ramus,S.J., Kuchenbaecker,K.B., Soucy,P., Beesley,J., Chen,X., Wang,X., Kirchhoff,T., McGuffog,L., Barrowdale,D., Lee,A., Healey,S., Sinilnikova,O.M., Andrulis,I.L., Ozcelik,H., Mulligan,A.M., Thomassen,M., Gerdes,A.M., Jensen,U.B., Skytte,A.B., Kruse,T.A., Caligo,M.A., von Wachenfeldt,A., Barbany-Bustinza,G., Loman,N., Soller,M., Ehrencrona,H., Karlsson,P., Nathanson,K.L., Rebbeck,T.R., Domchek,S.M., Jakubowska,A., Lubinski,J., Jaworska,K., Durda,K., Zlowocka,E., Huzarski,T., Byrski,T., Gronwald,J., Cybulski,C., Gorski,B., Osorio,A., Duran,M., Tejada,M.I., Benitez,J., Hamann,U., Hogervorst,F.B., van Os,T.A., van Leeuwen,F.E., Meijers-Heijboer,H.E., Wijnen,J., Blok,M.J., Kets,M., Hooning,M.J., Oldenburg,R.A., Ausems,M.G., Peock,S., Frost,D., Ellis,S.D., Platte,R., Fineberg,E., Evans,D.G., Jacobs,C., Eeles,R.A., Adlard,J., Davidson,R., Eccles,D.M., Cole,T., Cook,J., Paterson,J., Brewer,C., Douglas,F., Hodgson,S.V., Morrison,P.J., Walker,L., Porteous,M.E., Kennedy,M.J., Side,L.E., Bove,B., Godwin,A.K., Stoppa-Lyonnet,D., Fassy-Colcombet,M., Castera,L., Cornelis,F., Mazoyer,S., Leone,M., Boutry-Kryza,N., Bressac-de Paillerets,B., Caron,O., Pujol,P., Coupier,I., Delnatte,C., Akloul,L., Lynch,H.T., Snyder,C.L., Buys,S.S., Daly,M.B., Terry,M., Chung,W.K., John,E.M., Miron,A., Southey,M.C., Hopper,J.L., Goldgar,D.E., Singer,C.F., Rappaport,C., Tea,M.K., Fink-Retter,A., Hansen,T.V., Nielsen,F.C., Arason,A., Vijai,J., Shah,S., Sarrel,K., Robson,M.E., Piedmonte,M., Phillips,K., Basil,J., Rubinstein,W.S., Boggess,J., Wakeley,K., Ewart-Toland,A., Montagna,M., Agata,S., Imyanitov,E.N., Isaacs,C., Janavicius,R., Lazaro,C., Blanco,I., Feliubadalo,L., Brunet,J., Gayther,S.A., Pharoah,P.P., Odunsi,K.O., Karlan,B.Y., Walsh,C.S., Olah,E., Teo,S.H., Ganz,P.A., Beattie,M.S., van Rensburg,E.J., Dorfling,C.M., Diez,O., Kwong,A., Schmutzler,R.K., Wappenschmidt,B., Engel,C., Meindl,A., Ditsch,N., Arnold,N., Heidemann,S., Niederacher,D., Preisler-Adams,S., Gadzicki,D., Varon-Mateeva,R., Deissler,H., Gehrig,A., Sutter,C., Kast,K., Fiebig,B., Heinritz,W., Caldes,T., de la Hoya,M., Muranen,T.A., Nevanlinna,H., Tischkowitz,M.D., Spurdle,A.B., Neuhausen,S.L., Ding,Y.C., Lindor,N.M., Fredericksen,Z., Pankratz,V.S., Peterlongo,P., Manoukian,S., Peissel,B., Zaffaroni,D., Barile,M., Bernard,L., Viel,A., Giannini,G., Varesco,L., Radice,P., Greene,M.H., Mai,P.L., Easton,D.F., Chenevix-Trench,G., Offit,K. and Simard,J.
Journal Cancer Epidemiol. Biomarkers Prev. 21 (4), 645-657 (2012)
Title Genetic variants associated with breast size also influence breast cancer risk .
Author Eriksson,N., Benton,G.M., Do,C.B., Kiefer,A.K., Mountain,J.L., Hinds,D.A., Francke,U. and Tung,J.Y.
Journal BMC Med. Genet. 13, 53 (2012)
Title A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci .
Author Kenny,E.E., Pe'er,I., Karban,A., Ozelius,L., Mitchell,A.A., Ng,S.M., Erazo,M., Ostrer,H., Abraham,C., Abreu,M.T., Atzmon,G., Barzilai,N., Brant,S.R., Bressman,S., Burns,E.R., Chowers,Y., Clark,L.N., Darvasi,A., Doheny,D., Duerr,R.H., Eliakim,R., Giladi,N., Gregersen,P.K., Hakonarson,H., Jones,M.R., Marder,K., McGovern,D.P., Mulle,J., Orr-Urtreger,A., Proctor,D.D., Pulver,A., Rotter,J.I., Silverberg,M.S., Ullman,T., Warren,S.T., Waterman,M., Zhang,W., Bergman,A., Mayer,L., Katz,S., Desnick,R.J., Cho,J.H. and Peter,I.
Journal PLoS Genet. 8 (3), E1002559 (2012)
Title Characterization of Su48, a centrosome protein essential for cell division .
Author Wang,Q., Du,X., Meinkoth,J., Hirohashi,Y., Zhang,H., Liu,Q., Richter,M. and Greene,M.I.
Journal Proc. Natl. Acad. Sci. U.S.A. 103 (17), 6512-6517 (2006)
Title A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease .
Author Grupe,A., Li,Y., Rowland,C., Nowotny,P., Hinrichs,A.L., Smemo,S., Kauwe,J.S., Maxwell,T.J., Cherny,S., Doil,L., Tacey,K., van Luchene,R., Myers,A., Wavrant-De Vrieze,F., Kaleem,M., Hollingworth,P., Jehu,L., Foy,C., Archer,N., Hamilton,G., Holmans,P., Morris,C.M., Catanese,J., Sninsky,J., White,T.J., Powell,J., Hardy,J., O'Donovan,M., Lovestone,S., Jones,L., Morris,J.C., Thal,L., Owen,M., Williams,J. and Goate,A.
Journal Am. J. Hum. Genet. 78 (1), 78-88 (2006)
Title Emergence of Talanin protein associated with human uric acid nephrolithiasis in the Hominidae lineage .
Author Gianfrancesco,F., Esposito,T., Casu,G., Maninchedda,G., Roberto,R. and Pirastu,M.
Journal Gene 339, 131-138 (2004)
Title The DNA sequence and comparative analysis of human chromosome 10 .
Author Deloukas,P., Earthrowl,M.E., Grafham,D.V., Rubenfield,M., French,L., Steward,C.A., Sims,S.K., Jones,M.C., Searle,S., Scott,C., Howe,K., Hunt,S.E., Andrews,T.D., Gilbert,J.G., Swarbreck,D., Ashurst,J.L., Taylor,A., Battles,J., Bird,C.P., Ainscough,R., Almeida,J.P., Ashwell,R.I., Ambrose,K.D., Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Bates,K., Beasley,H., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Cahill,P., Camire,D., Carter,N.P., Chapman,J.C., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Corby,N., Coulson,A., Dhami,P., Dutta,I., Dunn,M., Faulkner,L., Frankish,A., Frankland,J.A., Garner,P., Garnett,J., Gribble,S., Griffiths,C., Grocock,R., Gustafson,E., Hammond,S., Harley,J.L., Hart,E., Heath,P.D., Ho,T.P., Hopkins,B., Horne,J., Howden,P.J., Huckle,E., Hynds,C., Johnson,C., Johnson,D., Kana,A., Kay,M., Kimberley,A.M., Kershaw,J.K., Kokkinaki,M., Laird,G.K., Lawlor,S., Lee,H.M., Leongamornlert,D.A., Laird,G., Lloyd,C., Lloyd,D.M., Loveland,J., Lovell,J., McLaren,S., McLay,K.E., McMurray,A., Mashreghi-Mohammadi,M., Matthews,L., Milne,S., Nickerson,T., Nguyen,M., Overton-Larty,E., Palmer,S.A., Pearce,A.V., Peck,A.I., Pelan,S., Phillimore,B., Porter,K., Rice,C.M., Rogosin,A., Ross,M.T., Sarafidou,T., Sehra,H.K., Shownkeen,R., Skuce,C.D., Smith,M., Standring,L., Sycamore,N., Tester,J., Thorpe,A., Torcasso,W., Tracey,A., Tromans,A., Tsolas,J., Wall,M., Walsh,J., Wang,H., Weinstock,K., West,A.P., Willey,D.L., Whitehead,S.L., Wilming,L., Wray,P.W., Young,L., Chen,Y., Lovering,R.C., Moschonas,N.K., Siebert,R., Fechtel,K., Bentley,D., Durbin,R., Hubbard,T., Doucette-Stamm,L., Beck,S., Smith,D.R. and Rogers,J.
Journal Nature 429 (6990), 375-381 (2004)
Title Identification of a novel gene and a common variant associated with uric acid nephrolithiasis in a Sardinian genetic isolate .
Author Gianfrancesco,F., Esposito,T., Ombra,M.N., Forabosco,P., Maninchedda,G., Fattorini,M., Casula,S., Vaccargiu,S., Casu,G., Cardia,F., Deiana,I., Melis,P., Falchi,M. and Pirastu,M.
Journal Am. J. Hum. Genet. 72 (6), 1479-1491 (2003)
Title Identification of a new candidate locus for uric acid nephrolithiasis .
Author Ombra,M.N., Forabosco,P., Casula,S., Angius,A., Maestrale,G., Petretto,E., Casu,G., Colussi,G., Usai,E., Melis,P. and Pirastu,M.
Journal Am. J. Hum. Genet. 68 (5), 1119-1129 (2001)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.