• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_014951 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_014951.2, 148596971
Length 4223 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA.
Product protein ZNF365 isoform A
Comment

Summary: This gene encodes several isoforms which have different expression patterns and functions. Mutation in this gene is associated with uric acid nephrolithiasis (UAN). Alternatively spliced variants, encoding distinct proteins, have been identified. [provided by RefSeq, May 2010].


Transcript Variant: This variant (A) differs in the 3' coding region and UTR compared to variant C. The resulting protein (isoform A) is shorter and has a distinct C-terminus compared to isoform C.

RefSeq NP_055766.2
CDS 316..1539
Misc Feature(1)217..219
Misc Feature(2)217..219
Misc Feature(3)<790..1257
Misc Feature(4)<790..1257
Exon (1)1..302
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (2)303..1058
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (3)1059..1239
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (4)1240..1277
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Exon (5)1278..4208
Gene:ZNF365
Gene Synonym:Su48; UAN; ZNF365D
Translation MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLT KCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAE RPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRI DKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESE EELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGF VRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPA KAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
279..281+, gcadbSNP:3830349
291..293+, gcadbSNP:397721595
291+a, gdbSNP:111930964
309+dbSNP:
309+c, tdbSNP:189552151
328+g, tdbSNP:371518407
378+c, tdbSNP:200922294
383+a, gdbSNP:144485380
394+c, tdbSNP:376736264
401+c, tdbSNP:191288886
435+c, gdbSNP:79142251
468+c, tdbSNP:142339866
474+c, tdbSNP:369710448
515+a, cdbSNP:373853921
545+a, cdbSNP:11545586
569+g, tdbSNP:145952676
655+c, tdbSNP:375914046
680+c, tdbSNP:143972122
710+g, tdbSNP:199867564
730+c, gdbSNP:199538761
757+c, tdbSNP:183722776
758+c, tdbSNP:201364250
786+c, tdbSNP:372546111
792+a, tdbSNP:375824552
851+a, gdbSNP:200762856
882+g, tdbSNP:139813334
890+c, tdbSNP:142196197
891+a, gdbSNP:370438883
908+a, gdbSNP:188391034
946+a, gdbSNP:372952136
984+c, tdbSNP:150802191
989+c, tdbSNP:61863383
1019+a, gdbSNP:139132215
1026+a, gdbSNP:376981865
1071+dbSNP:
1071+a, gdbSNP:148035675
1084+c, tdbSNP:192211282
1094+c, tdbSNP:367827531
1123+c, tdbSNP:184098438
1219+c, tdbSNP:116297631
1220+a, gdbSNP:374076744
1229+a, gdbSNP:368278289
1230+a, c, tdbSNP:200153426
1239+a, gdbSNP:191326652
1292+dbSNP:
1292+c, tdbSNP:147898988
1293+a, gdbSNP:141696527
1300+g, tdbSNP:145454121
1301+c, tdbSNP:138452965
1324+g, tdbSNP:3758490
1335+c, tdbSNP:149142683
1375+a, gdbSNP:376568719
1380+c, gdbSNP:143052727
1382+a, gdbSNP:373151582
1393+a, gdbSNP:200865539
1402+a, gdbSNP:200441783
1407+c, tdbSNP:148384716
1443+c, tdbSNP:372279589
complement(1516)-c, adbSNP:74950776
1560+c, tdbSNP:146162672
1563+c, tdbSNP:41307502
1565+a, gdbSNP:375504638
1639+c, tdbSNP:7899014
1655+a, gdbSNP:185083066
1689+a, gdbSNP:149449751
1937+c, tdbSNP:75879212
1993+a, gdbSNP:143879492
2105+c, gdbSNP:57005390
2107+c, tdbSNP:7902778
2108+a, gdbSNP:189121952
2155+a, gdbSNP:117342856
2222+a, gdbSNP:148627158
2233+c, gdbSNP:77856112
2256+c, gdbSNP:78777159
2306+a, gdbSNP:201679973
2320+c, gdbSNP:74623257
2431+c, tdbSNP:375881912
2432+a, gdbSNP:144307704
2478..2479+, ctdbSNP:143608968
2546+c, tdbSNP:76598947
2575+a, gdbSNP:200362979
2575+, gdbSNP:56738376
2577+, gdbSNP:397795204
2595+c, tdbSNP:41304617
2610+a, gdbSNP:181846077
2626+a, gdbSNP:74156193
2814+c, tdbSNP:12773319
2845+g, tdbSNP:56117326
3047+c, tdbSNP:115008445
3188+c, tdbSNP:186294967
3236+, tdbSNP:199574900
3237+, gdbSNP:5785521
3237+g, tdbSNP:202164670
3243+, gdbSNP:398075230
3244+g, tdbSNP:77309763
3245+a, tdbSNP:80269260
3332+c, tdbSNP:371517755
3385+a, cdbSNP:2893899
3438+a, tdbSNP:201595815
3462+a, tdbSNP:189527475
3513+g, tdbSNP:77702278
3546+c, gdbSNP:145285201
complement(3562)-g, adbSNP:151002719
3644+c, tdbSNP:74434092
3679+c, tdbSNP:76416315
3734+c, tdbSNP:372818401
3854+c, tdbSNP:180949518
3894+c, tdbSNP:186357198
3907+g, tdbSNP:200062549
4006+c, tdbSNP:191109977
4007+a, gdbSNP:76815522
4203..4204+, tgttdbSNP:374895638
Gene SymbolZNF365
Gene SynonymSu48; UAN; ZNF365D
Chromosome10
Locus Map10q21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_199450 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant B, mRNA. On-demand $549.00 14
NM_199451 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant C, mRNA. On-demand $699.00 18
NM_014951 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA. On-demand $549.00 14
NM_199452 Homo sapiens zinc finger protein 365 (ZNF365), transcript variant D, mRNA. On-demand $399.00 14
Title Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic .
Author Han F, Faraco J, Dong XS, Ollila HM, Lin L, Li J, An P, Wang S, Jiang KW, Gao ZC, Zhao L, Yan H, Liu YN, Li QH, Zhang XZ, Hu Y, Wang JY, Lu YH, Lu CJ, Zhou W, Hallmayer J, Huang YS, Strohl KP, Pollmacher T and Mignot E.
Journal PLoS Genet. 9 (10), E1003880 (2013)
Title ZNF365 promotes stalled replication forks recovery to maintain genome stability .
Author Zhang Y, Park E, Kim CS and Paik JH.
Journal Cell Cycle 12 (17), 2817-2828 (2013)
Title ZNF365 promotes stability of fragile sites and telomeres .
Author Zhang Y, Shin SJ, Liu D, Ivanova E, Foerster F, Ying H, Zheng H, Xiao Y, Chen Z, Protopopov A, Depinho RA and Paik JH.
Journal Cancer Discov 3 (7), 798-811 (2013)
Title Novel loci associated with increased risk of sudden cardiac death in the context of coronary artery disease .
Author Huertas-Vazquez A, Nelson CP, Guo X, Reinier K, Uy-Evanado A, Teodorescu C, Ayala J, Jerger K, Chugh H, Braund PS, Deloukas P, Hall AS, Balmforth AJ, Jones M, Taylor KD, Pulit SL, Newton-Cheh C, Gunson K, Jui J, Rotter JI, Albert CM, Samani NJ and Chugh SS.
Journal PLoS ONE 8 (4), E59905 (2013)
Title Characterization of Su48, a centrosome protein essential for cell division .
Author Wang Q, Du X, Meinkoth J, Hirohashi Y, Zhang H, Liu Q, Richter M and Greene MI.
Journal Proc. Natl. Acad. Sci. U.S.A. 103 (17), 6512-6517 (2006)
Title A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease .
Author Grupe A, Li Y, Rowland C, Nowotny P, Hinrichs AL, Smemo S, Kauwe JS, Maxwell TJ, Cherny S, Doil L, Tacey K, van Luchene R, Myers A, Wavrant-De Vrieze F, Kaleem M, Hollingworth P, Jehu L, Foy C, Archer N, Hamilton G, Holmans P, Morris CM, Catanese J, Sninsky J, White TJ, Powell J, Hardy J, O'Donovan M, Lovestone S, Jones L, Morris JC, Thal L, Owen M, Williams J and Goate A.
Journal Am. J. Hum. Genet. 78 (1), 78-88 (2006)
Title Emergence of Talanin protein associated with human uric acid nephrolithiasis in the Hominidae lineage .
Author Gianfrancesco F, Esposito T, Casu G, Maninchedda G, Roberto R and Pirastu M.
Journal Gene 339, 131-138 (2004)
Title The DNA sequence and comparative analysis of human chromosome 10 .
Author Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR and Rogers J.
Journal Nature 429 (6990), 375-381 (2004)
Title Identification of a novel gene and a common variant associated with uric acid nephrolithiasis in a Sardinian genetic isolate .
Author Gianfrancesco F, Esposito T, Ombra MN, Forabosco P, Maninchedda G, Fattorini M, Casula S, Vaccargiu S, Casu G, Cardia F, Deiana I, Melis P, Falchi M and Pirastu M.
Journal Am. J. Hum. Genet. 72 (6), 1479-1491 (2003)
Title Identification of a new candidate locus for uric acid nephrolithiasis .
Author Ombra MN, Forabosco P, Casula S, Angius A, Maestrale G, Petretto E, Casu G, Colussi G, Usai E, Melis P and Pirastu M.
Journal Am. J. Hum. Genet. 68 (5), 1119-1129 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.