• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu00112 Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu00112C Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_015259.5, 545688662
Length 909 bp
Structure linear
Update Date 13-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), transcript variant 1, mRNA.
Product ICOS ligand isoform a precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DC365972.1, AK314369.1, AP001058.1 and BQ005303.1. On Sep 25, 2013 this sequence version replaced gi:58331247.


Transcript Variant: This variant (1) represents the longest transcript and encodes isoform a.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_056074.1
CDS 188..1096
Misc Feature(1)281..532
Misc Feature(2)644..862
Misc Feature(3)956..1018
Exon (1)1..201
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (2)202..242
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (3)243..593
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (4)594..884
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (5)885..1049
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (6)1050..1085
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (7)1086..3303
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Translation MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG HV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(26)-dbSNP:
complement(26)-c, adbSNP:111946962
complement(53)-c, adbSNP:2847224
complement(59)-t, cdbSNP:75939338
complement(69..70)-, adbSNP:35622408
complement(233)-dbSNP:
complement(233)-g, adbSNP:371788513
complement(260)-dbSNP:
complement(260)-t, cdbSNP:200235698
complement(268)-t, cdbSNP:188124639
complement(280)-g, adbSNP:370843367
complement(281)-c, adbSNP:368372298
complement(283)-t, gdbSNP:144746466
complement(284)-t, cdbSNP:371610323
complement(343)-t, gdbSNP:149372524
complement(415)-t, cdbSNP:200042981
complement(422)-g, adbSNP:369596621
complement(423)-t, cdbSNP:61747082
complement(464)-g, adbSNP:370218763
complement(466)-g, cdbSNP:377111670
complement(478)-g, adbSNP:372958017
complement(482)-g, adbSNP:200561939
complement(483)-t, cdbSNP:61737085
complement(493)-g, adbSNP:373382817
complement(494)-t, cdbSNP:199766847
complement(498)-g, adbSNP:375915753
complement(522)-t, adbSNP:11701509
complement(561)-g, adbSNP:61737084
complement(567)-t, cdbSNP:147244364
569+a, gdbSNP:11558819
complement(581)-g, adbSNP:143732579
complement(587)-g, cdbSNP:201900032
complement(604)-dbSNP:
complement(604)-g, adbSNP:200543297
complement(610)-g, adbSNP:375815993
complement(611)-t, cdbSNP:372772395
complement(628)-g, adbSNP:201663098
complement(651)-g, adbSNP:370546780
complement(658)-c, adbSNP:181101499
complement(662)-t, gdbSNP:189208476
complement(691)-g, adbSNP:373042976
complement(701)-t, gdbSNP:369601615
complement(768)-t, cdbSNP:56105929
complement(802)-g, adbSNP:143097743
complement(803)-t, cdbSNP:140894768
complement(817)-g, adbSNP:373528374
848+c, tdbSNP:1062857
874+c, tdbSNP:1139814
complement(893)-dbSNP:
complement(893)-t, cdbSNP:201462822
complement(899)-t, cdbSNP:182215758
complement(938)-t, cdbSNP:201791685
complement(955)-t, cdbSNP:144780907
complement(991)-g, adbSNP:373630907
complement(992)-t, cdbSNP:370211236
complement(996)-g, adbSNP:200793282
complement(1002..1006)-, tatggdbSNP:147929506
complement(1002)-g, adbSNP:374009204
complement(1026)-t, cdbSNP:371137163
complement(1053)-dbSNP:
complement(1053)-g, adbSNP:199878735
complement(1068)-g, adbSNP:186459476
complement(1099)-dbSNP:
complement(1099)-t, cdbSNP:115284714
complement(1108)-g, cdbSNP:56292769
complement(1109)-c, adbSNP:371186534
complement(1133)-t, cdbSNP:55769116
complement(1140)-t, cdbSNP:374725627
complement(1145)-g, adbSNP:370580154
complement(1210)-g, adbSNP:114182853
complement(1393)-t, cdbSNP:74841947
complement(1408)-g, adbSNP:56335306
complement(1485)-t, cdbSNP:182577295
complement(1525)-g, cdbSNP:3804033
complement(1544)-g, adbSNP:147715450
complement(1549)-t, cdbSNP:373640783
complement(1645)-t, cdbSNP:370485408
complement(1685)-t, cdbSNP:73907125
complement(1728)-g, cdbSNP:147073178
complement(1754)-g, adbSNP:189862656
complement(1783)-g, adbSNP:371585030
complement(1867)-t, cdbSNP:185152562
complement(1914)-g, adbSNP:180834866
complement(1931)-t, cdbSNP:112574542
complement(2134)-t, cdbSNP:187117830
complement(2157..2173)-, gaccaccccgtctcctgdbSNP:11274942
complement(2159..2170)-, caccccgtctccdbSNP:55873166
complement(2160..2176)-, ctggaccaccccgtctcdbSNP:67226187
complement(2173..2175)-, tggdbSNP:55853339
complement(2178..2179)-, gcdbSNP:56026500
complement(2179)-g, adbSNP:117576800
complement(2235)-t, cdbSNP:3827253
complement(2252)-t, cdbSNP:182126616
complement(2341)-t, gdbSNP:115685804
complement(2357)-g, adbSNP:376109809
2367+a, gdbSNP:15927
complement(2442)-t, cdbSNP:8130802
complement(2558)-t, cdbSNP:9976668
complement(2592)-t, cdbSNP:4819388
complement(2599)-t, g, cdbSNP:58690004
complement(2654)-t, cdbSNP:80027278
complement(2734)-t, cdbSNP:372553184
complement(2788)-g, adbSNP:188822626
complement(2811)-t, cdbSNP:4819387
complement(2835)-g, adbSNP:183989755
complement(2836)-t, cdbSNP:113222980
complement(2945)-t, cdbSNP:73381375
complement(2962)-t, cdbSNP:113619423
complement(2981)-t, cdbSNP:181047945
complement(3023)-t, cdbSNP:3746961
complement(3151)-t, cdbSNP:188496544
complement(3177)-t, cdbSNP:374366377
complement(3193)-t, gdbSNP:184669736
Gene SymbolICOSLG
Gene SynonymB7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Chromosome21
Locus Map21q22.3
Title A functional variant at miR-24 binding site in B7-H2 alters susceptibility to gastric cancer in a Chinese Han population .
Author Yang P, Tang R, Zhu J, Zou L, Wu R, Zhou H, Mao Y, Li R, Hua D, Wang W and Zhang H.
Journal Mol. Immunol. 56 (1-2), 98-103 (2013)
Title Augmented ICOS expression in patients with early diffuse cutaneous systemic sclerosis .
Author Hasegawa M, Fujimoto M, Matsushita T, Hamaguchi Y and Takehara K.
Journal Rheumatology (Oxford) 52 (2), 242-251 (2013)
Title ICOS-ligand expression on plasmacytoid dendritic cells supports breast cancer progression by promoting the accumulation of immunosuppressive CD4+ T cells .
Author Faget J, Bendriss-Vermare N, Gobert M, Durand I, Olive D, Biota C, Bachelot T, Treilleux I, Goddard-Leon S, Lavergne E, Chabaud S, Blay JY, Caux C and Menetrier-Caux C.
Journal Cancer Res. 72 (23), 6130-6141 (2012)
Title Involvement of inducible costimulator ligand (ICOSL) expression in thyroid tissue in hyperthyroidism of Graves' disease patients .
Author Wang F, Yan T, Chen L, Chen X, Liu T, Shen S, Li T, Gao L, Wang T, Sun J, Liu C, Wu H, Zhang X and Chen L.
Journal J. Clin. Immunol. 32 (6), 1253-1261 (2012)
Title ICOS-LICOS interaction is critically involved in TGN1412-mediated T-cell activation .
Author Weissmuller S, Semmler LY, Kalinke U, Christians S, Muller-Berghaus
Journal Blood 119 (26), 6268-6277 (2012)
Title Differential expression of inducible costimulator-ligand splice variants: lymphoid regulation of mouse GL50-B and human GL50 molecules .
Author Ling V, Wu PW, Miyashiro JS, Marusic S, Finnerty HF and Collins M.
Journal J. Immunol. 166 (12), 7300-7308 (2001)
Title Costimulation of T cells by B7-H2, a B7-like molecule that binds .
Author Wang S, Zhu G, Chapoval AI, Dong H, Tamada K, Ni J and Chen L.
Journal Blood 96 (8), 2808-2813 (2000)
Title Characterization of a new human B7-related protein: B7RP-1 is the ligand to the co-stimulatory protein ICOS .
Author Yoshinaga SK, Zhang M, Pistillo J, Horan T, Khare SD, Miner K, Sonnenberg M, Boone T, Brankow D, Dai T, Delaney J, Han H, Hui A, Kohno T, Manoukian R, Whoriskey JS and Coccia MA.
Journal Int. Immunol. 12 (10), 1439-1447 (2000)
Title Characterization of human inducible costimulator ligand expression and function .
Author Aicher A, Hayden-Ledbetter M, Brady WA, Pezzutto A, Richter G, Magaletti D, Buckwalter S, Ledbetter JA and Clark EA.
Journal J. Immunol. 164 (9), 4689-4696 (2000)
Title Cutting edge: identification of GL50, a novel B7-like protein that functionally binds to ICOS receptor .
Author Ling V, Wu PW, Finnerty HF, Bean KM, Spaulding V, Fouser LA, Leonard JP, Hunter SE, Zollner R, Thomas JL, Miyashiro JS, Jacobs
Journal J. Immunol. 164 (4), 1653-1657 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.