• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_015259 Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_015259.4, 58331247
Length 3239 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), mRNA.
Product ICOS ligand precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK090492.1, BC064637.1 and AP001058.1. On Jan 29, 2005 this sequence version replaced gi:46255054.

RefSeq NP_056074.1
CDS 135..1043
Misc Feature(1)192..524
Misc Feature(2)222..524
Misc Feature(3)591..809
Misc Feature(4)903..965
Exon (1)1..148
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (2)149..189
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (3)190..540
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (4)541..831
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (5)832..996
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (6)997..1032
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Exon (7)1033..3239
Gene:ICOSLG
Gene Synonym:B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Translation MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG HV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(6)-dbSNP:
complement(6)-t, cdbSNP:75939338
complement(16..17)-, adbSNP:35622408
complement(207)-dbSNP:
complement(207)-t, cdbSNP:200235698
complement(215)-t, cdbSNP:188124639
complement(230)-t, gdbSNP:144746466
complement(290)-t, gdbSNP:149372524
complement(362)-t, cdbSNP:200042981
complement(370)-t, cdbSNP:61747082
complement(429)-g, adbSNP:200561939
complement(430)-t, cdbSNP:61737085
complement(441)-t, cdbSNP:199766847
complement(469)-t, adbSNP:11701509
complement(508)-g, adbSNP:61737084
complement(514)-t, cdbSNP:147244364
complement(516)-g, adbSNP:11558819
complement(528)-g, adbSNP:143732579
complement(534)-g, cdbSNP:201900032
complement(551)-dbSNP:
complement(551)-g, adbSNP:200543297
complement(575)-g, adbSNP:201663098
complement(605)-c, adbSNP:181101499
complement(609)-t, gdbSNP:189208476
complement(715)-t, cdbSNP:56105929
complement(749)-g, adbSNP:143097743
complement(750)-t, cdbSNP:140894768
complement(795)-t, cdbSNP:1062857
complement(821)-t, cdbSNP:1139814
complement(840)-dbSNP:
complement(840)-t, cdbSNP:201462822
complement(846)-t, cdbSNP:182215758
complement(885)-t, cdbSNP:201791685
complement(902)-t, cdbSNP:144780907
complement(943)-g, adbSNP:200793282
complement(949..953)-, tatggdbSNP:147929506
complement(1000)-dbSNP:
complement(1000)-g, adbSNP:199878735
complement(1015)-g, adbSNP:186459476
complement(1046)-dbSNP:
complement(1046)-t, cdbSNP:115284714
complement(1055)-g, cdbSNP:56292769
complement(1080)-t, cdbSNP:55769116
complement(1157)-g, adbSNP:114182853
complement(1340)-t, cdbSNP:74841947
complement(1355)-g, adbSNP:56335306
complement(1432)-t, cdbSNP:182577295
complement(1472)-g, cdbSNP:3804033
complement(1491)-g, adbSNP:147715450
complement(1632)-t, cdbSNP:73907125
complement(1675)-g, cdbSNP:147073178
complement(1701)-g, adbSNP:189862656
complement(1814)-t, cdbSNP:185152562
complement(1861)-g, adbSNP:180834866
complement(1878)-t, cdbSNP:112574542
complement(2081)-t, cdbSNP:187117830
complement(2104..2120)-, gaccaccccgtctcctgdbSNP:11274942
complement(2106)-, caccccgtctccdbSNP:55873166
complement(2107..2123)-, ctggaccaccccgtctcdbSNP:67226187
complement(2120..2122)-, tggdbSNP:55853339
complement(2125..2126)-, gcdbSNP:56026500
complement(2126)-g, adbSNP:117576800
complement(2182)-t, cdbSNP:3827253
complement(2199)-t, cdbSNP:182126616
complement(2288)-t, gdbSNP:115685804
complement(2314)-g, adbSNP:15927
complement(2389)-t, cdbSNP:8130802
complement(2505)-t, cdbSNP:9976668
complement(2539)-t, cdbSNP:4819388
complement(2546)-t, g, cdbSNP:58690004
complement(2601)-t, cdbSNP:80027278
complement(2735)-g, adbSNP:188822626
complement(2758)-t, cdbSNP:4819387
complement(2782)-g, adbSNP:183989755
complement(2783)-t, cdbSNP:113222980
complement(2892)-t, cdbSNP:73381375
complement(2909)-t, cdbSNP:113619423
complement(2928)-t, cdbSNP:181047945
complement(2970)-t, cdbSNP:3746961
complement(3098)-t, cdbSNP:188496544
complement(3140)-t, gdbSNP:184669736
Gene SymbolICOSLG
Gene SynonymB7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
Chromosome21
Locus Map21q22.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_015259 Homo sapiens inducible T-cell co-stimulator ligand (ICOSLG), mRNA. In-stock $348.00 $299.00 10
Title Augmented ICOS expression in patients with early diffuse cutaneous systemic sclerosis .
Author Hasegawa,M., Fujimoto,M., Matsushita,T., Hamaguchi,Y. and Takehara,K.
Journal Rheumatology (Oxford) 52 (2), 242-251 (2013)
Title ICOS-ligand expression on plasmacytoid dendritic cells supports breast cancer progression by promoting the accumulation of immunosuppressive CD4+ T cells .
Author Faget,J., Bendriss-Vermare,N., Gobert,M., Durand,I., Olive,D., Biota,C., Bachelot,T., Treilleux,I., Goddard-Leon,S., Lavergne,E., Chabaud,S., Blay,J.Y., Caux,C. and Menetrier-Caux,C.
Journal Cancer Res. 72 (23), 6130-6141 (2012)
Title ICOS-LICOS interaction is critically involved in TGN1412-mediated T-cell activation .
Author Weissmuller,S., Semmler,L.Y., Kalinke,U., Christians,S., Muller-Berghaus,J. and Waibler,Z.
Journal Blood 119 (26), 6268-6277 (2012)
Title B7-h2 is a costimulatory ligand for CD28 in human .
Author Yao,S., Zhu,Y., Zhu,G., Augustine,M., Zheng,L., Goode,D.J., Broadwater,M., Ruff,W., Flies,S., Xu,H., Flies,D., Luo,L., Wang,S. and Chen,L.
Journal Immunity 34 (5), 729-740 (2011)
Title Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47 .
Author Anderson,C.A., Boucher,G., Lees,C.W., Franke,A., D'Amato,M., Taylor,K.D., Lee,J.C., Goyette,P., Imielinski,M., Latiano,A., Lagace,C., Scott,R., Amininejad,L., Bumpstead,S., Baidoo,L., Baldassano,R.N., Barclay,M., Bayless,T.M., Brand,S., Buning,C., Colombel,J.F., Denson,L.A., De Vos,M., Dubinsky,M., Edwards,C., Ellinghaus,D., Fehrmann,R.S., Floyd,J.A., Florin,T., Franchimont,D., Franke,L., Georges,M., Glas,J., Glazer,N.L., Guthery,S.L., Haritunians,T., Hayward,N.K., Hugot,J.P., Jobin,G., Laukens,D., Lawrance,I., Lemann,M., Levine,A., Libioulle,C., Louis,E., McGovern,D.P., Milla,M., Montgomery,G.W., Morley,K.I., Mowat,C., Ng,A., Newman,W., Ophoff,R.A., Papi,L., Palmieri,O., Peyrin-Biroulet,L., Panes,J., Phillips,A., Prescott,N.J., Proctor,D.D., Roberts,R., Russell,R., Rutgeerts,P., Sanderson,J., Sans,M., Schumm,P., Seibold,F., Sharma,Y., Simms,L.A., Seielstad,M., Steinhart,A.H., Targan,S.R., van den Berg,L.H., Vatn,M., Verspaget,H., Walters,T., Wijmenga,C., Wilson,D.C., Westra,H.J., Xavier,R.J., Zhao,Z.Z., Ponsioen,C.Y., Andersen,V., Torkvist,L., Gazouli,M., Anagnou,N.P., Karlsen,T.H., Kupcinskas,L., Sventoraityte,J., Mansfield,J.C., Kugathasan,S., Silverberg,M.S., Halfvarson,J., Rotter,J.I., Mathew,C.G., Griffiths,A.M., Gearry,R., Ahmad,T., Brant,S.R., Chamaillard,M., Satsangi,J., Cho,J.H., Schreiber,S., Daly,M.J., Barrett,J.C., Parkes,M., Annese,V., Hakonarson,H., Radford-Smith,G., Duerr,R.H., Vermeire,S., Weersma,R.K. and Rioux,J.D.
Journal Nat. Genet. 43 (3), 246-252 (2011)
Title Differential expression of inducible costimulator-ligand splice variants: lymphoid regulation of mouse GL50-B and human GL50 molecules .
Author Ling,V., Wu,P.W., Miyashiro,J.S., Marusic,S., Finnerty,H.F. and Collins,M.
Journal J. Immunol. 166 (12), 7300-7308 (2001)
Title Costimulation of T cells by B7-H2, a B7-like molecule that binds .
Author Wang,S., Zhu,G., Chapoval,A.I., Dong,H., Tamada,K., Ni,J. and Chen,L.
Journal Blood 96 (8), 2808-2813 (2000)
Title Characterization of a new human B7-related protein: B7RP-1 is the ligand to the co-stimulatory protein ICOS .
Author Yoshinaga,S.K., Zhang,M., Pistillo,J., Horan,T., Khare,S.D., Miner,K., Sonnenberg,M., Boone,T., Brankow,D., Dai,T., Delaney,J., Han,H., Hui,A., Kohno,T., Manoukian,R., Whoriskey,J.S. and Coccia,M.A.
Journal Int. Immunol. 12 (10), 1439-1447 (2000)
Title Characterization of human inducible costimulator ligand expression and function .
Author Aicher,A., Hayden-Ledbetter,M., Brady,W.A., Pezzutto,A., Richter,G., Magaletti,D., Buckwalter,S., Ledbetter,J.A. and Clark,E.A.
Journal J. Immunol. 164 (9), 4689-4696 (2000)
Title Cutting edge: identification of GL50, a novel B7-like protein that functionally binds to ICOS receptor .
Author Ling,V., Wu,P.W., Finnerty,H.F., Bean,K.M., Spaulding,V., Fouser,L.A., Leonard,J.P., Hunter,S.E., Zollner,R., Thomas,J.L., Miyashiro,J.S., Jacobs,K.A. and Collins,M.
Journal J. Immunol. 164 (4), 1653-1657 (2000)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.