• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_015294 Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_015294.3, 189458899
Length 4520 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA.
Product E3 ubiquitin-protein ligase TRIM37
Comment

Summary: This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif and a coiled-coil domain. The RING finger and B-box domains chelate zinc and might be involved in protein-protein and/or protein-nucleic acid interactions. The gene mutations are associated with mulibrey (muscle-liver-brain-eye) nanism, an autosomal recessive disorder that involves several tissues of mesodermal origin. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein.

RefSeq NP_056109.1
CDS 445..3339
Misc Feature(1)286..288
Misc Feature(2)481..612
Misc Feature(3)481..612
Misc Feature(4)487..618
Misc Feature(5)order(487..489,496..498,535..537,541..543,550..552,
Misc Feature(6)721..840
Misc Feature(7)order(727..729,736..738,793..795,814..816)
Misc Feature(8)838..>1068
Misc Feature(9)1261..1662
Misc Feature(10)1408..1410
Misc Feature(11)order(1426..1428,1558..1566)
Misc Feature(12)2755..2757
Misc Feature(13)2761..2763
Exon (1)1..465
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (2)466..567
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (3)568..608
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (4)609..725
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (5)726..813
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (6)814..936
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (7)937..1060
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (8)1061..1128
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (9)1129..1253
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (10)1254..1304
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (11)1305..1386
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (12)1387..1463
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (13)1464..1643
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (14)1644..1758
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (15)1759..1974
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (16)1975..2111
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (17)2112..2197
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (18)2198..2392
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (19)2393..2701
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (20)2702..2830
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (21)2831..3020
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (22)3021..3139
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (23)3140..3256
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (24)3257..4516
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Translation MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII REFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDM LLEGGPTTASVREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASS TATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRR THLCSAATSSLLDIDPLILIHLLDLKDRSSIENLWGLQPRPPASLLQPTASYSRKDKDQR KQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAA LAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAGSLSLRRAVDP GENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGM SSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDE NSGR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(5)-dbSNP:
complement(5)-g, adbSNP:139395552
complement(48)-g, adbSNP:187845829
complement(101..102)-, adbSNP:34745555
complement(102)-g, cdbSNP:147238907
complement(105)-c, adbSNP:7503190
complement(221)-g, adbSNP:11541295
complement(242)-t, gdbSNP:182346107
525+dbSNP:
525+, gdbSNP:312262706
complement(546)-t, cdbSNP:202245230
complement(613)-dbSNP:
complement(613)-t, gdbSNP:140635645
complement(644)-t, cdbSNP:201317687
complement(709)-c, adbSNP:138861038
complement(740)-dbSNP:
complement(740)-t, cdbSNP:143241826
complement(766)-t, cdbSNP:17853504
complement(770)-g, cdbSNP:121908391
complement(842)-dbSNP:
complement(842)-g, adbSNP:61758100
complement(856)-g, cdbSNP:202005572
complement(890)-t, cdbSNP:201217878
complement(976)-dbSNP:
complement(976)-t, gdbSNP:113609806
complement(1019)-c, adbSNP:145646263
complement(1042)-t, cdbSNP:112080526
complement(1050)-t, cdbSNP:200498424
complement(1094)-dbSNP:
complement(1094)-t, adbSNP:149735804
complement(1116)-t, cdbSNP:185620415
complement(1142)-dbSNP:
complement(1142)-t, cdbSNP:200009152
complement(1228)-t, cdbSNP:200919462
complement(1356)-dbSNP:
complement(1356)-t, cdbSNP:145235211
complement(1450)-dbSNP:
complement(1450)-g, adbSNP:139604323
complement(1474)-dbSNP:
complement(1474)-g, adbSNP:151159335
complement(1487)-t, adbSNP:201631514
complement(1560)-g, adbSNP:201092472
complement(1596)-g, adbSNP:199714666
1610+a, gdbSNP:312262705
complement(1620)-t, cdbSNP:142064043
complement(1633)-t, cdbSNP:148604776
complement(1643)-t, cdbSNP:11868727
1677+dbSNP:
1677+, adbSNP:312262704
complement(1708)-g, adbSNP:74586224
complement(1720)-g, adbSNP:201308709
complement(1774)-dbSNP:
complement(1774)-g, adbSNP:143621221
complement(1801)-t, adbSNP:200578021
complement(1874)-t, cdbSNP:199823429
complement(1959)-c, adbSNP:2136373
complement(1961)-t, cdbSNP:77807605
complement(1977)-dbSNP:
complement(1977)-g, adbSNP:201513200
complement(1998)-g, cdbSNP:200825817
complement(2014)-c, adbSNP:143097255
complement(2174)-dbSNP:
complement(2174)-t, cdbSNP:139747073
complement(2183)-g, adbSNP:200411817
complement(2192)-t, gdbSNP:147363016
complement(2259)-dbSNP:
complement(2259)-g, adbSNP:142101613
complement(2260)-t, cdbSNP:199600276
2355..2356+, tadbSNP:312262703
complement(2363)-t, cdbSNP:112762655
complement(2421)-dbSNP:
complement(2421)-t, cdbSNP:140874364
2443+c, tdbSNP:312262702
complement(2466)-t, cdbSNP:200239638
complement(2482)-t, adbSNP:200084724
complement(2493)-t, cdbSNP:35871562
2569+, adbSNP:312262701
complement(2684)-t, cdbSNP:143613788
complement(2706)-dbSNP:
complement(2706)-t, cdbSNP:187769000
complement(2766)-g, adbSNP:113786386
complement(2768)-t, cdbSNP:148095355
complement(2781)-g, cdbSNP:200693005
complement(2811)-g, cdbSNP:143642427
complement(2817)-c, adbSNP:143459285
complement(2834)-dbSNP:
complement(2834)-g, adbSNP:142315375
complement(2874)-g, adbSNP:147639509
complement(2876)-t, cdbSNP:146986651
2882..2883+, atdbSNP:312262700
complement(2956)-t, cdbSNP:7222388
complement(2982)-c, adbSNP:76318483
complement(3077)-dbSNP:
complement(3077)-t, cdbSNP:201937328
complement(3162)-dbSNP:
complement(3162)-g, adbSNP:141167278
complement(3193)-t, cdbSNP:145524819
complement(3230)-g, adbSNP:201756873
complement(3268)-dbSNP:
complement(3268)-t, gdbSNP:149684009
complement(3511)-g, adbSNP:142113543
complement(3616)-t, cdbSNP:186804767
complement(3682)-g, adbSNP:112069339
complement(3712)-t, cdbSNP:145973955
complement(3823)-t, cdbSNP:182208565
complement(3836..3837)-, acadbSNP:72091333
complement(3910)-g, adbSNP:191255076
complement(3973)-t, adbSNP:28475409
complement(4002)-g, adbSNP:186395715
complement(4078)-g, adbSNP:183547492
complement(4098)-g, adbSNP:191702204
complement(4175)-t, cdbSNP:142111745
complement(4300)-t, cdbSNP:3826354
complement(4316)-, gdbSNP:112918162
complement(4364)-t, cdbSNP:914
complement(4369)-g, adbSNP:186389005
complement(4423)-g, adbSNP:12451581
complement(4428)-g, adbSNP:146140916
Gene SymbolTRIM37
Gene SynonymMUL; POB1; TEF3
Chromosome17
Locus Map17q23.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001005207 Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 2, mRNA. On-demand $899.00 20
NM_015294 Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA. On-demand $899.00 20
Title Shifted Transversal Design smart-pooling for high coverage interactome mapping .
Author Xin,X., Rual,J.F., Hirozane-Kishikawa,T., Hill,D.E., Vidal,M., Boone,C. and Thierry-Mieg,N.
Journal Genome Res. 19 (7), 1262-1269 (2009)
Title Gynecological tumors in Mulibrey nanism and role for RING finger protein TRIM37 in the pathogenesis of ovarian fibrothecomas .
Author Karlberg,S., Lipsanen-Nyman,M., Lassus,H., Kallijarvi,J., Lehesjoki,A.E. and Butzow,R.
Journal Mod. Pathol. 22 (4), 570-578 (2009)
Title A novel mutation in TRIM37 is associated with mulibrey nanism in a Turkish boy .
Author Doganc,T., Yuksel Konuk,B.E., Alpan,N., Konuk,O., Hamalainen,R.H., Lehesjoki,A.E. and Tekin,M.
Journal Clin. Dysmorphol. 16 (3), 173-176 (2007)
Title Wilms' tumor and novel TRIM37 mutations in an Australian patient with mulibrey nanism .
Author Hamalainen,R.H., Mowat,D., Gabbett,M.T., O'brien,T.A., Kallijarvi,J. and Lehesjoki,A.E.
Journal Clin. Genet. 70 (6), 473-479 (2006)
Title A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration .
Author Lim,J., Hao,T., Shaw,C., Patel,A.J., Szabo,G., Rual,J.F., Fisk,C.J., Li,N., Smolyar,A., Hill,D.E., Barabasi,A.L., Vidal,M. and Zoghbi,H.Y.
Journal Cell 125 (4), 801-814 (2006)
Title Expression of MUL, a gene encoding a novel RBCC family ring-finger protein, in human and mouse embryogenesis .
Author Lehesjoki,A.E., Reed,V.A., Mark Gardiner,R. and Greene,N.D.
Journal Mech. Dev. 108 (1-2), 221-225 (2001)
Title A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains .
Author Zapata,J.M., Pawlowski,K., Haas,E., Ware,C.F., Godzik,A. and Reed,J.C.
Journal J. Biol. Chem. 276 (26), 24242-24252 (2001)
Title The tripartite motif family identifies cell compartments .
Author Reymond,A., Meroni,G., Fantozzi,A., Merla,G., Cairo,S., Luzi,L., Riganelli,D., Zanaria,E., Messali,S., Cainarca,S., Guffanti,A., Minucci,S., Pelicci,P.G. and Ballabio,A.
Journal EMBO J. 20 (9), 2140-2151 (2001)
Title Gene encoding a new RING-B-box-Coiled-coil protein is mutated in mulibrey nanism .
Author Avela,K., Lipsanen-Nyman,M., Idanheimo,N., Seemanova,E., Rosengren,S., Makela,T.P., Perheentupa,J., Chapelle,A.D. and Lehesjoki,A.E.
Journal Nat. Genet. 25 (3), 298-301 (2000)
Title Assignment of the mulibrey nanism gene to 17q by linkage and linkage-disequilibrium analysis .
Author Avela,K., Lipsanen-Nyman,M., Perheentupa,J., Wallgren-Pettersson,C., Marchand,S., Faure,S., Sistonen,P., de la Chapelle,A. and Lehesjoki,A.E.
Journal Am. J. Hum. Genet. 60 (4), 896-902 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.