• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_015294 Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_015294.3, 189458899
Length 4520 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA.
Product E3 ubiquitin-protein ligase TRIM37
Comment

Summary: This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif and a coiled-coil domain. The RING finger and B-box domains chelate zinc and might be involved in protein-protein and/or protein-nucleic acid interactions. The gene mutations are associated with mulibrey (muscle-liver-brain-eye) nanism, an autosomal recessive disorder that involves several tissues of mesodermal origin. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein.

RefSeq NP_056109.1
CDS 445..3339
Misc Feature(1)286..288
Misc Feature(2)445..447
Misc Feature(3)445..447
Misc Feature(4)487..618
Misc Feature(5)order(487..489,496..498,535..537,541..543,550..552,
Misc Feature(6)721..840
Misc Feature(7)order(727..729,736..738,793..795,814..816)
Misc Feature(8)838..1206
Misc Feature(9)1261..1662
Misc Feature(10)1408..1410
Misc Feature(11)order(1426..1428,1558..1566)
Misc Feature(12)2755..2757
Misc Feature(13)2761..2763
Exon (1)1..465
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (2)466..567
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (3)568..608
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (4)609..725
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (5)726..813
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (6)814..936
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (7)937..1060
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (8)1061..1128
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (9)1129..1253
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (10)1254..1304
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (11)1305..1386
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (12)1387..1463
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (13)1464..1643
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (14)1644..1758
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (15)1759..1974
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (16)1975..2111
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (17)2112..2197
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (18)2198..2392
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (19)2393..2701
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (20)2702..2830
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (21)2831..3020
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (22)3021..3139
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (23)3140..3256
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Exon (24)3257..4516
Gene:TRIM37
Gene Synonym:MUL; POB1; TEF3
Translation MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII REFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDM LLEGGPTTASVREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASS TATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRR THLCSAATSSLLDIDPLILIHLLDLKDRSSIENLWGLQPRPPASLLQPTASYSRKDKDQR KQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAA LAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAGSLSLRRAVDP GENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGM SSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDE NSGR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(5)-dbSNP:
complement(5)-g, adbSNP:139395552
complement(39)-g, adbSNP:367815082
complement(48)-g, adbSNP:187845829
complement(66)-g, adbSNP:371030834
complement(101..102)-, adbSNP:34745555
complement(102)-g, cdbSNP:147238907
complement(105)-c, adbSNP:7503190
complement(209)-t, cdbSNP:371575547
221+a, gdbSNP:11541295
complement(242)-t, gdbSNP:182346107
complement(467)-dbSNP:
complement(467)-g, cdbSNP:374747161
complement(518)-g, adbSNP:370368388
525+, gdbSNP:312262706
complement(546)-t, cdbSNP:202245230
complement(594)-dbSNP:
complement(594)-t, cdbSNP:368063857
complement(607)-g, adbSNP:374185175
complement(613)-dbSNP:
complement(613)-t, gdbSNP:140635645
complement(625)-g, adbSNP:373520509
complement(644)-t, cdbSNP:201317687
671+c, tdbSNP:386834004
complement(694)-t, gdbSNP:370362829
complement(709)-c, adbSNP:138861038
complement(740)-dbSNP:
complement(740)-t, cdbSNP:143241826
complement(766)-t, cdbSNP:17853504
770+c, gdbSNP:121908391
complement(819)-dbSNP:
complement(819)-t, gdbSNP:369706031
complement(842)-g, adbSNP:61758100
complement(856)-g, cdbSNP:202005572
complement(890)-t, cdbSNP:201217878
complement(924)-t, cdbSNP:374974912
complement(976)-dbSNP:
complement(976)-t, gdbSNP:113609806
complement(1019)-c, adbSNP:145646263
complement(1042)-t, cdbSNP:112080526
complement(1044)-t, cdbSNP:372447673
complement(1050)-t, cdbSNP:200498424
complement(1094)-dbSNP:
complement(1094)-t, adbSNP:149735804
complement(1112)-t, cdbSNP:374078054
complement(1116)-t, cdbSNP:185620415
complement(1133)-dbSNP:
complement(1133)-t, cdbSNP:370363504
complement(1142)-t, cdbSNP:200009152
complement(1152)-t, cdbSNP:377517117
complement(1180)-t, gdbSNP:373950626
1189+c, tdbSNP:386834005
complement(1228)-t, cdbSNP:200919462
1282..1286+dbSNP:
1282..1286+, actttdbSNP:386834007
1304+a, gdbSNP:386834008
complement(1341)-dbSNP:
complement(1341)-t, cdbSNP:376783422
complement(1356)-t, cdbSNP:145235211
complement(1407)-dbSNP:
complement(1407)-t, adbSNP:369041706
1409+g, tdbSNP:386834009
complement(1450)-g, adbSNP:139604323
complement(1474)-dbSNP:
complement(1474)-g, adbSNP:151159335
complement(1475)-t, cdbSNP:373387394
1484..1485+, agatdbSNP:386833999
complement(1487)-t, adbSNP:201631514
complement(1501)-t, adbSNP:371764291
complement(1511)-g, cdbSNP:368037486
complement(1560)-g, adbSNP:201092472
complement(1596)-g, adbSNP:199714666
1610+a, gdbSNP:312262705
complement(1620)-t, cdbSNP:142064043
complement(1633)-t, cdbSNP:148604776
complement(1643)-t, cdbSNP:11868727
1677+dbSNP:
1677+, adbSNP:312262704
complement(1708)-g, adbSNP:74586224
complement(1720)-g, adbSNP:201308709
complement(1774)-dbSNP:
complement(1774)-g, adbSNP:143621221
complement(1777)-g, adbSNP:374221365
1790..1791+, adbSNP:386834000
complement(1801)-t, adbSNP:200578021
1855+c, tdbSNP:386834001
complement(1874)-t, cdbSNP:199823429
complement(1881)-g, cdbSNP:377532401
complement(1959)-c, adbSNP:2136373
1961+c, tdbSNP:77807605
complement(1977)-dbSNP:
complement(1977)-g, adbSNP:201513200
complement(1998)-g, cdbSNP:200825817
complement(2014)-c, adbSNP:143097255
complement(2174)-dbSNP:
complement(2174)-t, cdbSNP:139747073
complement(2183)-g, adbSNP:200411817
complement(2192)-t, gdbSNP:147363016
complement(2193)-g, adbSNP:373784343
complement(2259)-dbSNP:
complement(2259)-g, adbSNP:142101613
complement(2260)-t, cdbSNP:199600276
complement(2326)-g, adbSNP:377473747
2338..2339+, gadbSNP:386834002
2355..2356+, tadbSNP:312262703
complement(2357)-t, cdbSNP:373558056
complement(2359)-g, adbSNP:370881365
complement(2363)-t, cdbSNP:112762655
complement(2421)-dbSNP:
complement(2421)-t, cdbSNP:140874364
2443+c, tdbSNP:312262702
complement(2466)-t, cdbSNP:200239638
complement(2482)-t, adbSNP:200084724
complement(2493)-t, cdbSNP:35871562
2500+c, tdbSNP:386834003
2569+, adbSNP:312262701
complement(2575)-t, cdbSNP:373529399
complement(2634)-t, gdbSNP:368926657
complement(2639)-g, adbSNP:377316559
2656+, gdbSNP:386833416
complement(2672)-g, adbSNP:376290597
complement(2684)-t, cdbSNP:143613788
complement(2704)-dbSNP:
complement(2704)-t, cdbSNP:372392398
complement(2706)-t, cdbSNP:187769000
complement(2766)-g, adbSNP:113786386
complement(2768)-t, cdbSNP:148095355
complement(2773)-t, cdbSNP:376721539
complement(2781)-g, cdbSNP:200693005
complement(2811)-g, cdbSNP:143642427
complement(2817)-c, adbSNP:143459285
complement(2834)-dbSNP:
complement(2834)-g, adbSNP:142315375
complement(2874)-g, adbSNP:147639509
complement(2876)-t, cdbSNP:146986651
2882..2883+, atdbSNP:312262700
complement(2927)-t, cdbSNP:371137363
complement(2956)-t, cdbSNP:7222388
complement(2982)-c, adbSNP:76318483
complement(3077)-dbSNP:
complement(3077)-t, cdbSNP:201937328
complement(3151)-dbSNP:
complement(3151)-t, cdbSNP:376094664
complement(3162)-g, adbSNP:141167278
complement(3193)-t, cdbSNP:145524819
complement(3220)-c, adbSNP:375437566
complement(3230)-g, adbSNP:201756873
complement(3268)-dbSNP:
complement(3268)-t, gdbSNP:149684009
complement(3312)-g, adbSNP:368455664
complement(3327)-g, adbSNP:377282282
complement(3353)-t, cdbSNP:371565393
3511+a, gdbSNP:142113543
complement(3616)-t, cdbSNP:186804767
complement(3654)-t, cdbSNP:368314383
complement(3682)-g, adbSNP:112069339
complement(3708)-g, adbSNP:375182197
complement(3712)-t, cdbSNP:145973955
complement(3823)-t, cdbSNP:182208565
complement(3834..3835)-, acadbSNP:374423382
complement(3844..3845)-, tadbSNP:373015883
complement(3910)-g, adbSNP:191255076
complement(3973)-t, adbSNP:28475409
complement(4002)-g, adbSNP:186395715
complement(4078)-g, adbSNP:183547492
complement(4098)-g, adbSNP:191702204
complement(4113..4117)-, aagaadbSNP:372839088
complement(4175)-t, cdbSNP:142111745
complement(4300)-t, cdbSNP:3826354
complement(4316)-, gdbSNP:112918162
complement(4362)-t, cdbSNP:368742554
complement(4364)-t, cdbSNP:914
complement(4369)-g, adbSNP:186389005
complement(4423)-g, adbSNP:12451581
complement(4428)-g, adbSNP:146140916
Gene SymbolTRIM37
Gene SynonymMUL; POB1; TEF3
Chromosome17
Locus Map17q23.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_015294 Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 1, mRNA. On-demand $899.00 20
NM_001005207 Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant 2, mRNA. On-demand $899.00 20
XM_005257385 PREDICTED: Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant X1, mRNA. On-demand $899.00 20
XM_005257386 PREDICTED: Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant X2, mRNA. On-demand $899.00 20
XM_005257387 PREDICTED: Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant X3, mRNA. On-demand $899.00 20
XM_005257388 PREDICTED: Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant X4, mRNA. On-demand $899.00 20
XM_005257389 PREDICTED: Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant X5, mRNA. On-demand $899.00 20
XM_005257390 PREDICTED: Homo sapiens tripartite motif containing 37 (TRIM37), transcript variant X6, mRNA. On-demand $899.00 20
Title Anti-HIV-1 activity of Trim 37 .
Author Tabah AA, Tardif K and Mansky LM.
Journal J. Gen. Virol. 95 (PT 4), 960-967 (2014)
Title Refractory congestive heart failure following delayed pericardectomy in a 12-year-old child with Mulibrey nanism due to a novel mutation in TRIM37 .
Author Kumpf M, Hamalainen RH, Hofbeck M and Baden W.
Journal Eur. J. Pediatr. 172 (10), 1415-1418 (2013)
Title Meta-analysis identifies four new loci associated with testicular germ cell tumor .
Author Chung CC, Kanetsky PA, Wang Z, Hildebrandt MA, Koster R, Skotheim RI, Kratz CP, Turnbull C, Cortessis VK, Bakken AC, Bishop DT, Cook MB, Erickson RL, Fossa SD, Jacobs KB, Korde LA, Kraggerud SM, Lothe RA, Loud JT, Rahman N, Skinner EC, Thomas DC, Wu X, Yeager M, Schumacher FR, Greene MH, Schwartz SM, McGlynn KA, Chanock SJ and Nathanson KL.
Journal Nat. Genet. 45 (6), 680-685 (2013)
Title Shifted Transversal Design smart-pooling for high coverage interactome mapping .
Author Xin X, Rual JF, Hirozane-Kishikawa T, Hill DE, Vidal M, Boone C and Thierry-Mieg N.
Journal Genome Res. 19 (7), 1262-1269 (2009)
Title Gynecological tumors in Mulibrey nanism and role for RING finger protein TRIM37 in the pathogenesis of ovarian fibrothecomas .
Author Karlberg S, Lipsanen-Nyman M, Lassus H, Kallijarvi J, Lehesjoki AE and Butzow R.
Journal Mod. Pathol. 22 (4), 570-578 (2009)
Title Expression of MUL, a gene encoding a novel RBCC family ring-finger protein, in human and mouse embryogenesis .
Author Lehesjoki AE, Reed VA, Mark Gardiner R and Greene ND.
Journal Mech. Dev. 108 (1-2), 221-225 (2001)
Title A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains .
Author Zapata JM, Pawlowski K, Haas E, Ware CF, Godzik A and Reed JC.
Journal J. Biol. Chem. 276 (26), 24242-24252 (2001)
Title The tripartite motif family identifies cell compartments .
Author Reymond A, Meroni G, Fantozzi A, Merla G, Cairo S, Luzi L, Riganelli D, Zanaria E, Messali S, Cainarca S, Guffanti A, Minucci S, Pelicci PG and Ballabio A.
Journal EMBO J. 20 (9), 2140-2151 (2001)
Title Gene encoding a new RING-B-box-Coiled-coil protein is mutated in mulibrey nanism .
Author Avela K, Lipsanen-Nyman M, Idanheimo N, Seemanova E, Rosengren S, Makela TP, Perheentupa J, Chapelle AD and Lehesjoki AE.
Journal Nat. Genet. 25 (3), 298-301 (2000)
Title Assignment of the mulibrey nanism gene to 17q by linkage and linkage-disequilibrium analysis .
Author Avela K, Lipsanen-Nyman M, Perheentupa J, Wallgren-Pettersson C, Marchand S, Faure S, Sistonen P, de la Chapelle A and Lehesjoki AE.
Journal Am. J. Hum. Genet. 60 (4), 896-902 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.