Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA.
| RefSeq Version | NM_015455.3, 53829366 |
| Length | 6178 bp |
| Structure | linear |
| Update Date | 10-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA. |
| Product | CCR4-NOT transcription complex subunit 6 |
| Comment | Summary: The protein encoded by this gene is a subunit of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substates. [provided by RefSeq]. |
| RefSeq | NP_056270.2 |
| CDS | 350..2023 | Exon (1) | 1..347 | Exon (2) | 1..347 | Exon (3) | 348..461 | Exon (4) | 462..648 | Exon (5) | 649..734 | Exon (6) | 735..839 | Exon (7) | 840..908 | Exon (8) | 909..1066 | Exon (9) | 1067..1221 | Exon (10) | 1222..1376 | Exon (11) | 1377..1607 | Exon (12) | 1608..1810 | Exon (13) | 1811..6176 |
| Translation | MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSD
NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF
QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANA
HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG
VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYT
NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL
LLPFLPQVNGIHLPGRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(155) | - | c, a | dbSNP:75881322 |
| 220 | + | g, t | dbSNP:13177140 |
| 375 | + | c, t | dbSNP:75964385 |
| 1078 | + | a, g | dbSNP:61745063 |
| 1378 | + | c, t | dbSNP:6877400 |
| complement(1708) | - | t, c | dbSNP:34154769 |
| 1810 | + | g, t | dbSNP:116666866 |
| complement(1912) | - | g, c | dbSNP:34465748 |
| 1991 | + | a, g | dbSNP:75075055 |
| 2146 | + | g, t | dbSNP:78863822 |
| 2153 | + | c, t | dbSNP:111320376 |
| 2212 | + | a, g | dbSNP:72816959 |
| 2244..2245 | + | , a | dbSNP:35324011 |
| 2479 | + | c, t | dbSNP:113600014 |
| 2560 | + | a, t | dbSNP:72816960 |
| 2695 | + | c, t | dbSNP:73812615 |
| 2936 | + | a, g | dbSNP:115537412 |
| 3237..3238 | + | , ttgcagtgtgctgcttgtcacccagaatactactatcatgt | dbSNP:6149379 |
| 3256 | + | a, g | dbSNP:6880907 |
| 3293 | + | g, t | dbSNP:76117789 |
| 3296 | + | g, t | dbSNP:79997014 |
| 3318 | + | c, g | dbSNP:112870765 |
| 3643 | + | g, t | dbSNP:72816961 |
| 3672 | + | a, c | dbSNP:34524755 |
| 3716 | + | , t | dbSNP:67755652 |
| 3726..3727 | + | , tt | dbSNP:74274488 |
| 3727 | + | , t | dbSNP:35687441 |
| 3728 | + | c, t | dbSNP:115923255 |
| 3813 | + | g, t | dbSNP:7380295 |
| 3908 | + | c, t | dbSNP:10069 |
| 4603..4604 | + | , g | dbSNP:35816990 |
| 4818 | + | a, g | dbSNP:114930603 |
| 4823 | + | c, t | dbSNP:11747088 |
| 4976..4977 | + | actccagaaatgtg, tctccagaaa | dbSNP:71577048 |
| 4977 | + | a, t | dbSNP:11738060 |
| 4995..4996 | + | , tgtg | dbSNP:72488761 |
| 4996..4997 | + | , gtgtgt | dbSNP:71896310 |
| 4997 | + | c, t | dbSNP:76381917 |
| 4998..4999 | + | , gt | dbSNP:71845067 |
| 5008 | + | g, t | dbSNP:72816963 |
| 5010..5011 | + | , tgtg | dbSNP:10679604 |
| 5011..5012 | + | , tgtg | dbSNP:34562273 |
| 5012..5013 | + | , gtgtgt | dbSNP:72340510 |
| 5014..5015 | + | , g, t, tgtgtgtt | dbSNP:7730917 |
| 5014 | + | g, t | dbSNP:28591219 |
| 5015..5016 | + | , tgtgtgtt | dbSNP:35158468 |
| 5019..5020 | + | , gt, gtgt, gtgtgt, gtgtgtgt | dbSNP:57499439 |
| 5020..5021 | + | , gtgt | dbSNP:72128950 |
| 5020 | + | g, t | dbSNP:77422417 |
| 5129 | + | a, t | dbSNP:76324806 |
| 5145 | + | c, t | dbSNP:72816964 |
| 5170 | + | a, g | dbSNP:1043287 |
| 5563 | + | c, t | dbSNP:11957870 |
| complement(5652) | - | t, c | dbSNP:15804 |
| complement(5838) | - | t, c | dbSNP:9079 |
| 5964 | + | a, g | dbSNP:58577966 |
| 6032 | + | a, c | dbSNP:14457 |
| 6073 | + | g, t | dbSNP:115935546 |
| 6086 | + | c, t | dbSNP:17080395 |
| Title | Human Ccr4-Not complexes contain variable deadenylase subunits . |
| Author | Lau,N.C., Kolkman,A., van Schaik,F.M., Mulder,K.W., Pijnappel,W.W., Heck,A.J. and Timmers,H.T. |
| Journal | Biochem. J. 422 (3), 443-453 (2009) |
| Title | hCCR4/cNOT6 targets DNA-damage response proteins . |
| Author | Sanchez-Perez,I., Manguan-Garcia,C., Menacho-Marquez,M., Murguia,J.R. and Perona,R. |
| Journal | Cancer Lett. 273 (2), 281-291 (2009) |
| Title | Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1 . |
| Author | Garapaty,S., Mahajan,M.A. and Samuels,H.H. |
| Journal | J. Biol. Chem. 283 (11), 6806-6816 (2008) |
| Title | Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth . |
| Author | Morita,M., Suzuki,T., Nakamura,T., Yokoyama,K., Miyasaka,T. and Yamamoto,T. |
| Journal | Mol. Cell. Biol. 27 (13), 4980-4990 (2007) |
| Title | Transcriptome analysis of human gastric cancer . |
| Author | Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S. |
| Journal | Mamm. Genome 16 (12), 942-954 (2005) |
| Title | BTG2 antiproliferative protein interacts with the human CCR4 complex existing in vivo in three cell-cycle-regulated forms . |
| Author | Morel,A.P., Sentis,S., Bianchin,C., Le Romancer,M., Jonard,L., Rostan,M.C., Rimokh,R. and Corbo,L. |
| Journal | J. Cell. Sci. 116 (PT 14), 2929-2936 (2003) |
| Title | CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase . |
| Author | Chen,J., Chiang,Y.C. and Denis,C.L. |
| Journal | EMBO J. 21 (6), 1414-1426 (2002) |
| Title | Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding . |
| Author | Dupressoir,A., Morel,A.P., Barbot,W., Loireau,M.P., Corbo,L. and Heidmann,T. |
| Journal | BMC Genomics 2, 9 (2001) |
| Title | Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits . |
| Author | Albert,T.K., Lemaire,M., van Berkum,N.L., Gentz,R., Collart,M.A. and Timmers,H.T. |
| Journal | Nucleic Acids Res. 28 (3), 809-817 (2000) |
| Title | Monitoring cell physiology by expression profiles and discovering cell type-specific genes by compiled expression profiles . |
| Author | Okubo,K., Itoh,K., Fukushima,A., Yoshii,J. and Matsubara,K. |
| Journal | Genomics 30 (2), 178-186 (1995) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |