• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA.


RefSeq Accession Definition Services Price Order
NM_015455 Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA. ORF Sequence $485.46
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_015455.3, 53829366
Length 6178 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA.
Product CCR4-NOT transcription complex subunit 6
Comment

Summary: The protein encoded by this gene is a subunit of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substates. [provided by RefSeq, Jul 2008].

RefSeq NP_056270.2
CDS 350..2023
Misc Feature(1)155..157
Misc Feature(2)155..157
Misc Feature(3)500..622
Misc Feature(4)500..622
Misc Feature(5)503..568
Misc Feature(6)572..637
Misc Feature(7)641..709
Misc Feature(8)710..778
Misc Feature(9)920..1948
Misc Feature(10)order(932..934,1067..1069,1430..1432,1439..1441,
Misc Feature(11)order(932..934,1067..1069,1430..1432,1439..1441,
Misc Feature(12)order(932..934,1067..1069,1430..1432,1583..1585,
Misc Feature(13)order(932..934,1067..1069,1937..1939)
Misc Feature(14)order(1430..1432,1589..1591,1940..1942)
Misc Feature(15)order(1583..1585,1589..1591,1940..1942)
Exon (1)1..347
Gene:CNOT6
Gene Synonym:CCR4
Exon (2)348..461
Gene:CNOT6
Gene Synonym:CCR4
Exon (3)462..648
Gene:CNOT6
Gene Synonym:CCR4
Exon (4)649..734
Gene:CNOT6
Gene Synonym:CCR4
Exon (5)735..839
Gene:CNOT6
Gene Synonym:CCR4
Exon (6)840..908
Gene:CNOT6
Gene Synonym:CCR4
Exon (7)909..1066
Gene:CNOT6
Gene Synonym:CCR4
Exon (8)1067..1221
Gene:CNOT6
Gene Synonym:CCR4
Exon (9)1222..1376
Gene:CNOT6
Gene Synonym:CCR4
Exon (10)1377..1607
Gene:CNOT6
Gene Synonym:CCR4
Exon (11)1608..1810
Gene:CNOT6
Gene Synonym:CCR4
Exon (12)1811..6176
Gene:CNOT6
Gene Synonym:CCR4
Translation MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSD NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEP DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQE VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANA HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYT NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL LLPFLPQVNGIHLPGRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
155+a, cdbSNP:75881322
220+g, tdbSNP:13177140
375+c, tdbSNP:75964385
384+a, gdbSNP:200597146
415+a, gdbSNP:151053718
511+dbSNP:
511+a, tdbSNP:201226463
597+c, tdbSNP:139798355
727+dbSNP:
727+c, tdbSNP:199907095
809+dbSNP:
809+c, gdbSNP:200257488
836+a, gdbSNP:199712153
837+g, tdbSNP:149805830
895+dbSNP:
895+c, gdbSNP:188923586
971+dbSNP:
971+a, gdbSNP:145701342
1052+a, gdbSNP:201594351
1078+dbSNP:
1078+a, gdbSNP:61745063
1163+a, gdbSNP:147102262
1202+a, gdbSNP:147748063
1232+dbSNP:
1232+c, gdbSNP:142504544
1351+a, tdbSNP:200912651
1353+g, tdbSNP:143354534
1370+a, gdbSNP:148358771
1374+c, tdbSNP:138268797
1378+dbSNP:
1378+c, tdbSNP:6877400
1394+a, gdbSNP:150124040
1438+c, tdbSNP:202095631
1539+c, gdbSNP:138378919
1704+dbSNP:
1704+a, gdbSNP:141532758
1708+c, tdbSNP:34154769
1750+a, gdbSNP:146260092
1884+dbSNP:
1884+a, gdbSNP:139424567
1909+c, tdbSNP:142530209
1912+c, gdbSNP:34465748
1960+a, gdbSNP:144015585
1980+g, tdbSNP:200539269
1991+a, gdbSNP:75075055
2136+c, tdbSNP:187936736
2146+g, tdbSNP:78863822
2153+c, tdbSNP:111320376
2212+a, gdbSNP:72816959
2244..2245+, adbSNP:35324011
2338+a, gdbSNP:191595700
2400+a, tdbSNP:183694126
2479+c, tdbSNP:113600014
2545+a, gdbSNP:188161072
2560+a, tdbSNP:72816960
2644+c, tdbSNP:145986158
2695+c, tdbSNP:73812615
2761+c, tdbSNP:185387009
2803+c, gdbSNP:190280622
2936+a, gdbSNP:115537412
3004+a, gdbSNP:142039489
3237..3238+, ttgcagtgtgctgcttgtcacccagaatactactatcatgtdbSNP:6149379
3252+a, gdbSNP:181699027
3256+a, gdbSNP:6880907
3271+g, tdbSNP:186754078
3275..3276+, ttgdbSNP:145144360
3296+a, cdbSNP:201521256
3318+c, gdbSNP:112870765
3457+a, gdbSNP:188462692
3596+g, tdbSNP:180967483
3629+c, tdbSNP:185139124
3643+g, tdbSNP:72816961
3672+a, cdbSNP:34524755
3706+a, gdbSNP:150832621
3716..3717+, ttdbSNP:74274488
3716+, tdbSNP:35687441
3726+c, tdbSNP:189599761
3728+a, gdbSNP:201035675
3790+c, tdbSNP:183242686
3813+g, tdbSNP:7380295
3881+c, tdbSNP:139245842
3908+c, tdbSNP:10069
3970+, tdbSNP:143024153
4231+a, gdbSNP:187006554
4487+a, gdbSNP:192040988
4599+a, gdbSNP:183410300
4601+a, gdbSNP:188363858
4603..4604+, gdbSNP:35816990
4605+g, tdbSNP:191842623
4629+a, gdbSNP:182581439
4681+c, tdbSNP:186809713
4818+a, gdbSNP:114930603
4823+c, tdbSNP:11747088
4877+a, gdbSNP:191273227
4976..4977+actccagaaatgtg, tctccagaaadbSNP:71577048
4977+a, tdbSNP:11738060
4986..4987+, tgtgtgtgdbSNP:139637444
4987..4988+, tgtgdbSNP:34562273
4988..4989+, gt, gtgt, gtgtgtdbSNP:71845067
4990..4991+, gtgtgtdbSNP:71896310
4997+c, tdbSNP:76381917
5010..5011+, tgtgdbSNP:10679604
5014..5015+g, tdbSNP:7730917
5014+g, tdbSNP:28591219
5015..5016+, tgtgtgttdbSNP:35158468
5019..5020+, gtgtgtgtdbSNP:200504154
5019..5020+, gt, gtgt, gtgtgt, gtgtgtgtdbSNP:57499439
5047+a, gdbSNP:190379168
5145+c, tdbSNP:72816964
5170+a, gdbSNP:1043287
5269+a, cdbSNP:193182970
5296+c, tdbSNP:185110304
5322+c, gdbSNP:188802606
5367+a, gdbSNP:149974800
5563+c, tdbSNP:11957870
5652+c, tdbSNP:15804
5673+a, gdbSNP:145419812
5759+c, tdbSNP:140974960
5815+a, tdbSNP:181268004
5838+c, tdbSNP:9079
5937+c, tdbSNP:185276313
5960+a, gdbSNP:188188763
5962+a, gdbSNP:180817926
5964+a, gdbSNP:58577966
5988..5989+, ggdbSNP:141782375
6003+c, tdbSNP:144865584
6032+a, cdbSNP:14457
6073+g, tdbSNP:115935546
6086+c, tdbSNP:17080395
Gene SymbolCNOT6
Gene SynonymCCR4
Chromosome5
Locus Map5q35.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_015455 Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA. Full Length $2780.10
ORF Sequence $485.46
Title The Ccr4a (CNOT6) and Ccr4b (CNOT6L) deadenylase subunits of the human Ccr4-Not complex contribute to the prevention of cell death and senescence .
Author Mittal,S., Aslam,A., Doidge,R., Medica,R. and Winkler,G.S.
Journal Mol. Biol. Cell 22 (6), 748-758 (2011)
Title Human Ccr4-Not complexes contain variable deadenylase subunits .
Author Lau,N.C., Kolkman,A., van Schaik,F.M., Mulder,K.W., Pijnappel,W.W., Heck,A.J. and Timmers,H.T.
Journal Biochem. J. 422 (3), 443-453 (2009)
Title hCCR4/cNOT6 targets DNA-damage response proteins .
Author Sanchez-Perez,I., Manguan-Garcia,C., Menacho-Marquez,M., Murguia,J.R. and Perona,R.
Journal Cancer Lett. 273 (2), 281-291 (2009)
Title Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1 .
Author Garapaty,S., Mahajan,M.A. and Samuels,H.H.
Journal J. Biol. Chem. 283 (11), 6806-6816 (2008)
Title Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth .
Author Morita,M., Suzuki,T., Nakamura,T., Yokoyama,K., Miyasaka,T. and Yamamoto,T.
Journal Mol. Cell. Biol. 27 (13), 4980-4990 (2007)
Title BTG2 antiproliferative protein interacts with the human CCR4 complex existing in vivo in three cell-cycle-regulated forms .
Author Morel,A.P., Sentis,S., Bianchin,C., Le Romancer,M., Jonard,L., Rostan,M.C., Rimokh,R. and Corbo,L.
Journal J. Cell. Sci. 116 (PT 14), 2929-2936 (2003)
Title CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase .
Author Chen,J., Chiang,Y.C. and Denis,C.L.
Journal EMBO J. 21 (6), 1414-1426 (2002)
Title Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding .
Author Dupressoir,A., Morel,A.P., Barbot,W., Loireau,M.P., Corbo,L. and Heidmann,T.
Journal BMC Genomics 2, 9 (2001)
Title Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits .
Author Albert,T.K., Lemaire,M., van Berkum,N.L., Gentz,R., Collart,M.A. and Timmers,H.T.
Journal Nucleic Acids Res. 28 (3), 809-817 (2000)
Title Monitoring cell physiology by expression profiles and discovering cell type-specific genes by compiled expression profiles .
Author Okubo,K., Itoh,K., Fukushima,A., Yoshii,J. and Matsubara,K.
Journal Genomics 30 (2), 178-186 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878