• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu40046 Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu40046C Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_015455.3, 53829366
Length 1674 bp
Structure linear
Update Date 19-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA.
Product CCR4-NOT transcription complex subunit 6
Comment

Summary: The protein encoded by this gene is a subunit of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substates. [provided by RefSeq, Jul 2008].

RefSeq NP_056270.2
CDS 350..2023
Misc Feature(1)155..157
Misc Feature(2)500..676
Misc Feature(3)500..676
Misc Feature(4)500..622
Misc Feature(5)503..568
Misc Feature(6)569..679
Misc Feature(7)572..637
Misc Feature(8)641..748
Misc Feature(9)641..709
Misc Feature(10)710..778
Misc Feature(11)806..2020
Misc Feature(12)920..1969
Misc Feature(13)order(932..934,1067..1069,1430..1432,1439..1441,
Misc Feature(14)order(932..934,1067..1069,1430..1432,1439..1441,
Misc Feature(15)order(932..934,1067..1069,1430..1432,1583..1585,
Misc Feature(16)order(932..934,1067..1069,1937..1939)
Misc Feature(17)order(1430..1432,1589..1591,1940..1942)
Misc Feature(18)order(1583..1585,1589..1591,1940..1942)
Exon (1)1..347
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (2)348..461
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (3)462..648
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (4)649..734
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (5)735..839
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (6)840..908
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (7)909..1066
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (8)1067..1221
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (9)1222..1376
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (10)1377..1607
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (11)1608..1810
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Exon (12)1811..6176
Gene:CNOT6
Gene Synonym:CCR4; Ccr4a
Translation MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSD NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEP DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQE VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANA HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYT NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL LLPFLPQVNGIHLPGRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
63+dbSNP:
63+, cdbSNP:369259087
155+a, cdbSNP:75881322
220+g, tdbSNP:13177140
375+c, tdbSNP:75964385
384+a, gdbSNP:200597146
415+a, gdbSNP:151053718
448+a, gdbSNP:368230568
481+dbSNP:
481+c, tdbSNP:368715440
511+a, tdbSNP:201226463
521+c, tdbSNP:371414037
597+c, tdbSNP:139798355
611+a, tdbSNP:375846017
620+a, gdbSNP:368192786
626+c, gdbSNP:371582649
637+a, gdbSNP:374888368
709+dbSNP:
709+c, tdbSNP:372696271
727+c, tdbSNP:199907095
791+dbSNP:
791+c, tdbSNP:370738638
809+c, gdbSNP:200257488
836+a, c, gdbSNP:199712153
837+g, tdbSNP:149805830
843+dbSNP:
843+a, cdbSNP:371474479
895+c, gdbSNP:188923586
906+c, tdbSNP:373787258
934+dbSNP:
934+c, tdbSNP:372064704
971+a, gdbSNP:145701342
1015+a, gdbSNP:376434714
1052+a, gdbSNP:201594351
1078+dbSNP:
1078+a, gdbSNP:61745063
1163+a, gdbSNP:147102262
1202+a, gdbSNP:147748063
1232+dbSNP:
1232+c, gdbSNP:142504544
1351+a, tdbSNP:200912651
1353+g, tdbSNP:143354534
1370+a, gdbSNP:148358771
1374+c, tdbSNP:138268797
1378+dbSNP:
1378+c, tdbSNP:6877400
1394+a, gdbSNP:150124040
1398+c, gdbSNP:377314143
1409+c, tdbSNP:371184209
1438+c, tdbSNP:202095631
1476+c, tdbSNP:375570858
1489+c, tdbSNP:376346658
1539+c, gdbSNP:138378919
1663+dbSNP:
1663+a, gdbSNP:368152537
1704+a, gdbSNP:141532758
complement(1708)-t, cdbSNP:34154769
1750+a, gdbSNP:146260092
1851+dbSNP:
1851+a, cdbSNP:371901301
1884+a, gdbSNP:139424567
1906+c, tdbSNP:376755263
1909+c, tdbSNP:142530209
complement(1912)-g, cdbSNP:34465748
1960+a, gdbSNP:144015585
1980+g, tdbSNP:200539269
1981+a, cdbSNP:369770382
1987+c, tdbSNP:371846418
1991+a, gdbSNP:75075055
2008+g, tdbSNP:374072064
2024+c, tdbSNP:376542751
2136+c, tdbSNP:187936736
2146+g, tdbSNP:78863822
2153+c, tdbSNP:111320376
2212+a, gdbSNP:72816959
2244..2245+, adbSNP:35324011
2338+a, gdbSNP:191595700
2400+a, tdbSNP:183694126
2479+c, tdbSNP:113600014
2545+a, gdbSNP:188161072
2560+a, tdbSNP:72816960
2620+a, gdbSNP:375533367
2623..2624+, ttdbSNP:377054939
2644+c, tdbSNP:145986158
2695+c, tdbSNP:73812615
2761+c, tdbSNP:185387009
2803+c, gdbSNP:190280622
2936+a, gdbSNP:115537412
3004+a, gdbSNP:142039489
3252+a, gdbSNP:181699027
3256+a, gdbSNP:6880907
3271+g, tdbSNP:186754078
3275..3276+, ttgdbSNP:145144360
3276..3277+, ttgdbSNP:371491974
3296+a, cdbSNP:201521256
3318+c, gdbSNP:112870765
3413+a, gdbSNP:377102860
3457+a, gdbSNP:188462692
3596+g, tdbSNP:180967483
3629+c, tdbSNP:185139124
3643+g, tdbSNP:72816961
3672+a, cdbSNP:34524755
3706+a, gdbSNP:150832621
3716+, tdbSNP:35687441
3726..3727+, ttdbSNP:74274488
3726+c, tdbSNP:189599761
3728+a, gdbSNP:201035675
3728+a, gdbSNP:386460751
3790+c, tdbSNP:183242686
3813+g, tdbSNP:7380295
3881+c, tdbSNP:139245842
3908+c, tdbSNP:10069
3970+, tdbSNP:143024153
4231+a, gdbSNP:187006554
4487+a, gdbSNP:192040988
4599+a, gdbSNP:183410300
4601+a, gdbSNP:188363858
4603..4604+, gdbSNP:35816990
4605+g, tdbSNP:191842623
4629+a, gdbSNP:182581439
4681+c, tdbSNP:186809713
4751+a, gdbSNP:367909255
4818+a, gdbSNP:114930603
4823+c, tdbSNP:11747088
4877+a, gdbSNP:191273227
4976..4977+actccagaaatgtg, tctccagaaadbSNP:71577048
4977+a, tdbSNP:11738060
4986..4987+, tgtgtg, tgtgtgtgdbSNP:139637444
4988+a, gdbSNP:370242658
4997+c, tdbSNP:76381917
5014+g, tdbSNP:7730917
5014+g, tdbSNP:28591219
5019..5020+, gt, gtgt, gtgtgt, gtgtgtg, gtgtgtgtdbSNP:57499439
5047+a, gdbSNP:190379168
5145+c, tdbSNP:72816964
5170+a, gdbSNP:1043287
5224+a, tdbSNP:368772153
5269+a, cdbSNP:193182970
5296+c, tdbSNP:185110304
5322+c, gdbSNP:188802606
5367+a, gdbSNP:149974800
5494+a, gdbSNP:373712029
5563+c, tdbSNP:11957870
5565+a, cdbSNP:376617985
complement(5652)-t, cdbSNP:15804
5671..5674+, tcagdbSNP:370065861
5673+a, gdbSNP:145419812
complement(5759)-t, cdbSNP:140974960
5815+a, tdbSNP:181268004
complement(5838)-t, cdbSNP:9079
5890+a, gdbSNP:367748564
5931+a, gdbSNP:371698431
5937+c, tdbSNP:185276313
5960+a, gdbSNP:188188763
5962+a, gdbSNP:180817926
5964+a, gdbSNP:58577966
5988..5989+, ggdbSNP:141782375
6003+c, tdbSNP:144865584
6032+a, cdbSNP:14457
6073+g, tdbSNP:115935546
6086+c, tdbSNP:17080395
Gene SymbolCNOT6
Gene SynonymCCR4; Ccr4a
Chromosome5
Locus Map5q35.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_015455 Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), mRNA. On-demand $219.00 7-9
XM_005265953 PREDICTED: Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_006714899 PREDICTED: Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), transcript variant X2, mRNA. On-demand $219.00 7-9
XM_006714900 PREDICTED: Homo sapiens CCR4-NOT transcription complex, subunit 6 (CNOT6), transcript variant X3, mRNA. On-demand $219.00 7-9
Title The Ccr4a (CNOT6) and Ccr4b (CNOT6L) deadenylase subunits of the human Ccr4-Not complex contribute to the prevention of cell death and senescence .
Author Mittal S, Aslam A, Doidge R, Medica R and Winkler GS.
Journal Mol. Biol. Cell 22 (6), 748-758 (2011)
Title Human Ccr4-Not complexes contain variable deadenylase subunits .
Author Lau NC, Kolkman A, van Schaik FM, Mulder KW, Pijnappel WW, Heck AJ and Timmers HT.
Journal Biochem. J. 422 (3), 443-453 (2009)
Title hCCR4/cNOT6 targets DNA-damage response proteins .
Author Sanchez-Perez I, Manguan-Garcia C, Menacho-Marquez M, Murguia JR and Perona R.
Journal Cancer Lett. 273 (2), 281-291 (2009)
Title Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1 .
Author Garapaty S, Mahajan MA and Samuels HH.
Journal J. Biol. Chem. 283 (11), 6806-6816 (2008)
Title Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth .
Author Morita M, Suzuki T, Nakamura T, Yokoyama K, Miyasaka T and Yamamoto T.
Journal Mol. Cell. Biol. 27 (13), 4980-4990 (2007)
Title BTG2 antiproliferative protein interacts with the human CCR4 complex existing in vivo in three cell-cycle-regulated forms .
Author Morel AP, Sentis S, Bianchin C, Le Romancer M, Jonard L, Rostan MC, Rimokh R and Corbo L.
Journal J. Cell. Sci. 116 (PT 14), 2929-2936 (2003)
Title CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase .
Author Chen J, Chiang YC and Denis CL.
Journal EMBO J. 21 (6), 1414-1426 (2002)
Title Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding .
Author Dupressoir A, Morel AP, Barbot W, Loireau MP, Corbo L and Heidmann T.
Journal BMC Genomics 2, 9 (2001)
Title Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits .
Author Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA and Timmers HT.
Journal Nucleic Acids Res. 28 (3), 809-817 (2000)
Title Monitoring cell physiology by expression profiles and discovering cell type-specific genes by compiled expression profiles .
Author Okubo K, Itoh K, Fukushima A, Yoshii J and Matsubara K.
Journal Genomics 30 (2), 178-186 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.