• THAT   AND
  • THAT   AND


Homo sapiens SET binding protein 1 (SETBP1), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_015559 Homo sapiens SET binding protein 1 (SETBP1), transcript variant 1, mRNA. Full Lenth Quote
ORF Sequence $1676.85


RefSeq Version NM_015559.2, 194294553
Length 9899 bp
Structure linear
Update Date 10-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens SET binding protein 1 (SETBP1), transcript variant 1, mRNA.
Product SET-binding protein isoform a
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC146776.1, AC105074.5, BQ641251.1 and AC090376.6. This sequence is a reference standard in the RefSeqGene project. On Jul 17, 2008 this sequence version replaced gi:7662121.


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. COMPLETENESS: complete on the 3' end.

RefSeq NP_056374.2
CDS 297..5087
Exon (1)1..124
Exon (2)1..124
Exon (3)125..782
Exon (4)783..836
Exon (5)837..4296
Exon (6)4297..4467
Exon (7)4468..9899
Translation MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEE DELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNL ENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQ AYERPQKHSTLHYDTGLPQDFTGDTLKPKHQQKSSSQNHMDWSTNSDSGPVTQNCFISPE SGRETASTSKIPALEPVASFAKAQGKKGSAGNTWSQLSNNNKDLLLGGVAPSPSSHSSPA PPSSSAECNGLQPLVDQDGGGTKEPPEPPTVGSKKKSSKKDVISQTIPNPDLDWVKNAQK AFDNTEGKREGYSADSAQEASPARQNVSSASNPENDSSHVRITIPIKAPSLDPTNHKRKK RQSIKAVVEKIMPEKALASGITMSSEVVNRILSNSEGNKKDPRVPKLSKMIENESPSVGL ETGGNAEKVIPGGVSKPRKPPMVMTPPTCTDHSPSRKLPEIQHPKFAAKRRWTCSKPKPS TMLREAVMATSDKLMLEPPSAYPITPSSPLYTNTDSLTVITPVKKKRGRPKKQPLLTVET IHEGTSTSPVSPISREFPGTKKRKRRRNLAKLAQLVPGEDKPMSEMKFHKKVGKLGVLDK KTIKTINKMKTLKRKNILNQILSCSSSVALKAKAPPETSPGAAAIESKLGKQINVSKRGT IYIGKKRGRKPRAELPPPSEEPKTAIKHPRPVSSQPDVPAVPSNFQSLVASSPAAMHPLS TQLGGSNGNLSPASTETNFSELKTMPNLQPISALPTKTQKGIHSGTWKLSPPRLMANSPS HLCEIGSLKEITLSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYSFDFCSLD NPEAIPSDTSTKNRHGHRQKHLIVDNFLAHESLKKPKHKRKRKSLQNRDDLQFLADLEEL ITKFQVFRISHRSYTFYHENPYPSIFRINFDHYYPVPYIQYDPLLYLRRTSDLKSKKKRG RPAKTNDTMTKVPFLQGFSYPIPSGSYYAPYGMPYTSMPMMNLGYYGQYPAPLYLSHTLG AASPFMRPTVPPPQFHTNSHVKMSGAAKHKAKHGVHLQGPVSMGLGDMQPSLNPPKVGSA SLSSGRLHKRKHKHKHKHKEDRILGTHDNLSGLFAGKATGFSSHILSERLSSADKELPLV SEKNKHKEKQKHQHSEAGHKASKNNFEVDTLSTLSLSDAQHWTQAKEKGDLSSEPVDSCT KRYSGSGGDGGSTRSENLDVFSEMNPSNDKWDSDVSGSKRRSYEGFGTYREKDIQAFKMN RKERSSYDSSMSPGMPSPHLKVDQTAVHSKNEGSVPTMMTRKKPAAVDSVTIPPAPVLSL LAASAATSDAVGSSLKKRFKRREIEAIQCEVRKMCNYTKILSTKKNLDHVNKILKAKRLQ RQSKTGNNFVKKRRGRPRKQPTQFDEDSRDQMPVLEKCIDLPSKRGQKPSLSPLVLEPAA SQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAP AQPPQQSPPQQPLPQEEEVKAKRQRKSRGSESEVLP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
42+g, tdbSNP:77168280
521+a, gdbSNP:111324550
763+a, gdbSNP:75248959
930+a, cdbSNP:79615803
987+c, gdbSNP:11082414
1109..1110+, gdbSNP:35468095
1454+c, tdbSNP:73472918
1466+c, tdbSNP:8091231
1688+, cdbSNP:35885973
1787+a, gdbSNP:113053616
2083+c, tdbSNP:113699859
2228+c, tdbSNP:3744824
2438+c, tdbSNP:111865740
2903+c, tdbSNP:74499808
2909..2910+, gdbSNP:36110095
3002+a, gdbSNP:113916801
3033+a, gdbSNP:112590414
3122+a, gdbSNP:80187617
3597+a, gdbSNP:3744825
3658+c, tdbSNP:113314121
3684+a, cdbSNP:1064204
3840+c, tdbSNP:78016724
3914+c, tdbSNP:34882016
4102+a, gdbSNP:79938638
4121+a, gdbSNP:8096662
4425+c, gdbSNP:77518617
4427+a, gdbSNP:35460875
4694+g, tdbSNP:117498128
5559+a, tdbSNP:1056570
5563+c, tdbSNP:1056571
5837+g, tdbSNP:75103090
5900+c, gdbSNP:7233404
5920+c, tdbSNP:73952954
5923+a, gdbSNP:117690446
6197+a, cdbSNP:117071310
6204..6205+, aadbSNP:10691360
6214+, adbSNP:57937684
6216+a, gdbSNP:77643098
6588+a, gdbSNP:76196861
6832+a, tdbSNP:73431734
6890..6891+, cdbSNP:34921199
6904+a, gdbSNP:9963575
7204+a, cdbSNP:79775144
7346+a, tdbSNP:1349385
7557+, adbSNP:34338523
7761+a, gdbSNP:57173867
7971+c, tdbSNP:112813646
7988+a, cdbSNP:7244247
8059+, tdbSNP:34125334
8064+, tdbSNP:72236913
8180+g, tdbSNP:74404175
8266+a, gdbSNP:72898811
8432+a, cdbSNP:115098550
8468+a, gdbSNP:75848480
8487..8488+, cdbSNP:34738582
8763+c, tdbSNP:117464906
8922+c, tdbSNP:112551826
8971+g, tdbSNP:117797575
9337+a, cdbSNP:77706244
9412..9413+, adbSNP:35849833
9597+c, tdbSNP:76077260
9830+, adbSNP:10715988
Gene SymbolSETBP1
Gene SynonymDKFZp666J1210; KIAA0437; SEB
Chromosome18
Locus Map18q21.1
All Transcripts NM_015559 , NM_001130110
Title Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction .
Author Sotoodehnia,N., Isaacs,A., de Bakker,P.I., Dorr,M., Newton-Cheh,C., Nolte,I.M., van der Harst,P., Muller,M., Eijgelsheim,M., Alonso,A., Hicks,A.A., Padmanabhan,S., Hayward,C., Smith,A.V., Polasek,O., Giovannone,S., Fu,J., Magnani,J.W., Marciante,K.D., Pfeufer,A., Gharib,S.A., Teumer,A., Li,M., Bis,J.C., Rivadeneira,F., Aspelund,T., Kottgen,A., Johnson,T., Rice,K., Sie,M.P., Wang,Y.A., Klopp,N., Fuchsberger,C., Wild,S.H., Mateo Leach,I., Estrada,K., Volker,U., Wright,A.F., Asselbergs,F.W., Qu,J., Chakravarti,A., Sinner,M.F., Kors,J.A., Petersmann,A., Harris,T.B., Soliman,E.Z., Munroe,P.B., Psaty,B.M., Oostra,B.A., Cupples,L.A., Perz,S., de Boer,R.A., Uitterlinden,A.G., Volzke,H., Spector,T.D., Liu,F.Y., Boerwinkle,E., Dominiczak,A.F., Rotter,J.I., van Herpen,G., Levy,D., Wichmann,H.E., van Gilst,W.H., Witteman,J.C., Kroemer,H.K., Kao,W.H., Heckbert,S.R., Meitinger,T., Hofman,A., Campbell,H., Folsom,A.R., van Veldhuisen,D.J., Schwienbacher,C., O'Donnell,C.J., Volpato,C.B., Caulfield,M.J., Connell,J.M., Launer,L., Lu,X., Franke,L., Fehrmann,R.S., te Meerman,G., Groen,H.J., Weersma,R.K., van den Berg,L.H., Wijmenga,C., Ophoff,R.A., Navis,G., Rudan,I., Snieder,H., Wilson,J.F., Pramstaller,P.P., Siscovick,D.S., Wang,T.J., Gudnason,V., van Duijn,C.M., Felix,S.B., Fishman,G.I., Jamshidi,Y., Stricker,B.H., Samani,N.J., Kaab,S. and Arking,D.E.
Journal Nat. Genet. 42 (12), 1068-1076 (2010)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score .
Author Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R.
Journal Mol. Med. 16 (7-8), 247-253 (2010)
Title De novo mutations of SETBP1 cause Schinzel-Giedion syndrome .
Author Hoischen,A., van Bon,B.W., Gilissen,C., Arts,P., van Lier,B., Steehouwer,M., de Vries,P., de Reuver,R., Wieskamp,N., Mortier,G., Devriendt,K., Amorim,M.Z., Revencu,N., Kidd,A., Barbosa,M., Turner,A., Smith,J., Oley,C., Henderson,A., Hayes,I.M., Thompson,E.M., Brunner,H.G., de Vries,B.B. and Veltman,J.A.
Journal Nat. Genet. 42 (6), 483-485 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud,P.J., Drenos,F., Shah,S., Shah,T., Palmen,J., Verzilli,C., Gaunt,T.R., Pallas,J., Lovering,R., Li,K., Casas,J.P., Sofat,R., Kumari,M., Rodriguez,S., Johnson,T., Newhouse,S.J., Dominiczak,A., Samani,N.J., Caulfield,M., Sever,P., Stanton,A., Shields,D.C., Padmanabhan,S., Melander,O., Hastie,C., Delles,C., Ebrahim,S., Marmot,M.G., Smith,G.D., Lawlor,D.A., Munroe,P.B., Day,I.N., Kivimaki,M., Whittaker,J., Humphries,S.E. and Hingorani,A.D.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Correction of X-linked chronic granulomatous disease by gene therapy, augmented by insertional activation of MDS1-EVI1, PRDM16 or SETBP1 .
Author Ott,M.G., Schmidt,M., Schwarzwaelder,K., Stein,S., Siler,U., Koehl,U., Glimm,H., Kuhlcke,K., Schilz,A., Kunkel,H., Naundorf,S., Brinkmann,A., Deichmann,A., Fischer,M., Ball,C., Pilz,I., Dunbar,C., Du,Y., Jenkins,N.A., Copeland,N.G., Luthi,U., Hassan,M., Thrasher,A.J., Hoelzer,D., von Kalle,C., Seger,R. and Grez,M.
Journal Nat. Med. 12 (4), 401-409 (2006)
Title The human plasma proteome: a nonredundant list developed by combination of four separate sources .
Author Anderson,N.L., Polanski,M., Pieper,R., Gatlin,T., Tirumalai,R.S., Conrads,T.P., Veenstra,T.D., Adkins,J.N., Pounds,J.G., Fagan,R. and Lobley,A.
Journal Mol. Cell Proteomics 3 (4), 311-326 (2004)
Title Identification and characterization of SEB, a novel protein that binds to the acute undifferentiated leukemia-associated protein SET .
Author Minakuchi,M., Kakazu,N., Gorrin-Rivas,M.J., Abe,T., Copeland,T.D., Ueda,K. and Adachi,Y.
Journal Eur. J. Biochem. 268 (5), 1340-1351 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878