• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SET binding protein 1 (SETBP1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_015559 Homo sapiens SET binding protein 1 (SETBP1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_015559.2, 194294553
Length 9899 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens SET binding protein 1 (SETBP1), transcript variant 1, mRNA.
Product SET-binding protein isoform a
Comment

Summary: This gene encodes a protein which contains a several motifs including a ski homology region and a SET-binding region in addition to three nuclear localization signals. The encoded protein has been shown to bind the SET nuclear oncogene which is involved in DNA replication. Mutations in this gene are associated with Schinzel-Giedion midface retraction syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_056374.2
CDS 297..5087
Misc Feature(1)267..269
Misc Feature(2)4092..4094
Misc Feature(3)4092..4094
Misc Feature(4)4110..4112
Misc Feature(5)4854..4925
Exon (1)1..124
Gene:SETBP1
Gene Synonym:SEB
Exon (2)125..782
Gene:SETBP1
Gene Synonym:SEB
Exon (3)783..836
Gene:SETBP1
Gene Synonym:SEB
Exon (4)837..4296
Gene:SETBP1
Gene Synonym:SEB
Exon (5)4297..4467
Gene:SETBP1
Gene Synonym:SEB
Exon (6)4468..9899
Gene:SETBP1
Gene Synonym:SEB
Translation MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEE DELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNL ENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQ AYERPQKHSTLHYDTGLPQDFTGDTLKPKHQQKSSSQNHMDWSTNSDSGPVTQNCFISPE SGRETASTSKIPALEPVASFAKAQGKKGSAGNTWSQLSNNNKDLLLGGVAPSPSSHSSPA PPSSSAECNGLQPLVDQDGGGTKEPPEPPTVGSKKKSSKKDVISQTIPNPDLDWVKNAQK AFDNTEGKREGYSADSAQEASPARQNVSSASNPENDSSHVRITIPIKAPSLDPTNHKRKK RQSIKAVVEKIMPEKALASGITMSSEVVNRILSNSEGNKKDPRVPKLSKMIENESPSVGL ETGGNAEKVIPGGVSKPRKPPMVMTPPTCTDHSPSRKLPEIQHPKFAAKRRWTCSKPKPS TMLREAVMATSDKLMLEPPSAYPITPSSPLYTNTDSLTVITPVKKKRGRPKKQPLLTVET IHEGTSTSPVSPISREFPGTKKRKRRRNLAKLAQLVPGEDKPMSEMKFHKKVGKLGVLDK KTIKTINKMKTLKRKNILNQILSCSSSVALKAKAPPETSPGAAAIESKLGKQINVSKRGT IYIGKKRGRKPRAELPPPSEEPKTAIKHPRPVSSQPDVPAVPSNFQSLVASSPAAMHPLS TQLGGSNGNLSPASTETNFSELKTMPNLQPISALPTKTQKGIHSGTWKLSPPRLMANSPS HLCEIGSLKEITLSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYSFDFCSLD NPEAIPSDTSTKNRHGHRQKHLIVDNFLAHESLKKPKHKRKRKSLQNRDDLQFLADLEEL ITKFQVFRISHRSYTFYHENPYPSIFRINFDHYYPVPYIQYDPLLYLRRTSDLKSKKKRG RPAKTNDTMTKVPFLQGFSYPIPSGSYYAPYGMPYTSMPMMNLGYYGQYPAPLYLSHTLG AASPFMRPTVPPPQFHTNSHVKMSGAAKHKAKHGVHLQGPVSMGLGDMQPSLNPPKVGSA SLSSGRLHKRKHKHKHKHKEDRILGTHDNLSGLFAGKATGFSSHILSERLSSADKELPLV SEKNKHKEKQKHQHSEAGHKASKNNFEVDTLSTLSLSDAQHWTQAKEKGDLSSEPVDSCT KRYSGSGGDGGSTRSENLDVFSEMNPSNDKWDSDVSGSKRRSYEGFGTYREKDIQAFKMN RKERSSYDSSMSPGMPSPHLKVDQTAVHSKNEGSVPTMMTRKKPAAVDSVTIPPAPVLSL LAASAATSDAVGSSLKKRFKRREIEAIQCEVRKMCNYTKILSTKKNLDHVNKILKAKRLQ RQSKTGNNFVKKRRGRPRKQPTQFDEDSRDQMPVLEKCIDLPSKRGQKPSLSPLVLEPAA SQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAP AQPPQQSPPQQPLPQEEEVKAKRQRKSRGSESEVLP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
42+dbSNP:
42+g, tdbSNP:77168280
133+dbSNP:
133+c, gdbSNP:145284354
183+c, tdbSNP:183515719
263+c, gdbSNP:376964078
277+a, gdbSNP:202134217
361+a, tdbSNP:185998256
437+a, gdbSNP:146868426
440+c, tdbSNP:371516078
444+a, gdbSNP:368634398
449+c, tdbSNP:372870881
451+a, gdbSNP:375461817
457+a, gdbSNP:140717709
467+a, gdbSNP:148596984
506+g, tdbSNP:142975703
518+c, tdbSNP:151108179
521+a, gdbSNP:111324550
584+a, gdbSNP:368521359
605+a, gdbSNP:200639817
626+a, gdbSNP:190818714
698+a, gdbSNP:199906212
708+g, tdbSNP:144184206
739+a, gdbSNP:376890297
763+a, gdbSNP:75248959
770+c, tdbSNP:374289352
803+dbSNP:
803+c, tdbSNP:201939233
805+c, tdbSNP:141225535
867+dbSNP:
867+c, tdbSNP:146994409
902+c, tdbSNP:371436709
911+a, cdbSNP:138039719
930+a, cdbSNP:79615803
941+c, tdbSNP:202152985
980+c, tdbSNP:149073567
981+a, gdbSNP:143196787
986+c, tdbSNP:377615601
987+a, c, gdbSNP:11082414
1053+a, gdbSNP:149472556
1064+c, tdbSNP:141858699
1065+a, gdbSNP:144967125
1109..1110+, gdbSNP:35468095
1158+a, gdbSNP:267605185
1204+a, gdbSNP:370644058
1207+a, gdbSNP:200286635
1223+c, tdbSNP:199603131
1265+a, gdbSNP:138913968
1283+c, tdbSNP:371212525
1329+a, cdbSNP:374418839
1334+c, tdbSNP:367985500
1344+c, tdbSNP:142034944
1347+g, tdbSNP:370610721
1377+g, tdbSNP:146321232
1379+a, gdbSNP:373675944
1383+g, tdbSNP:201685079
1396+c, gdbSNP:367742803
1416+a, gdbSNP:372096992
1454+c, tdbSNP:73472918
1455+a, gdbSNP:368829088
1466+c, tdbSNP:8091231
1496+c, gdbSNP:372407089
1497+c, tdbSNP:200966921
1498+a, gdbSNP:144407969
1506+a, gdbSNP:369385623
1544+c, tdbSNP:144249054
1573+c, tdbSNP:187433533
1635+g, tdbSNP:147768665
1675+a, gdbSNP:199597517
1683+c, tdbSNP:201930325
1688+, cdbSNP:35885973
1757+a, gdbSNP:369535510
1779+a, tdbSNP:138515058
1786+c, tdbSNP:145133915
1787+a, gdbSNP:113053616
1799+c, tdbSNP:374300895
1801+c, tdbSNP:189891219
1802+g, tdbSNP:140838391
1823+c, tdbSNP:377726234
1877+g, tdbSNP:150136756
1885+a, gdbSNP:371223842
1927+a, gdbSNP:201672132
1938+a, gdbSNP:200023639
1952+c, tdbSNP:145656108
1973+a, gdbSNP:201699775
2083+c, tdbSNP:113699859
2123+c, tdbSNP:140403091
2124+a, gdbSNP:200927313
2173+a, gdbSNP:369475378
2175+c, tdbSNP:146193261
2176+a, gdbSNP:138819848
2212+a, gdbSNP:187990800
2228+c, tdbSNP:3744824
2261+c, tdbSNP:372765743
2264+c, tdbSNP:377372011
2291+g, tdbSNP:370910099
2352+a, tdbSNP:376810199
2358+a, gdbSNP:370618204
2438+c, tdbSNP:111865740
2457+a, tdbSNP:199698418
2465+c, tdbSNP:374032905
2555+c, tdbSNP:141924960
2563+c, tdbSNP:200368452
2604+g, tdbSNP:199810775
2606+a, gdbSNP:373845529
2656+a, gdbSNP:143716526
2680+c, gdbSNP:148108984
2729+c, tdbSNP:141960143
2796+c, tdbSNP:368785192
2825+c, tdbSNP:199582335
2852+a, gdbSNP:150665941
2862+g, tdbSNP:140028039
2888+a, gdbSNP:372383442
2897+c, tdbSNP:376371660
2898+a, gdbSNP:267607042
2899+a, cdbSNP:267607041
2903+c, tdbSNP:74499808
2904+a, gdbSNP:267607040
2905+a, gdbSNP:267607039
2908+c, tdbSNP:267607038
2909..2910+, gdbSNP:36110095
2951+c, gdbSNP:143325806
2999+c, tdbSNP:147524056
3001+c, gdbSNP:139479590
3002+a, gdbSNP:113916801
3013+c, tdbSNP:144966931
3017+c, tdbSNP:148632511
3033+a, gdbSNP:112590414
3052+a, gdbSNP:376849711
3077+c, tdbSNP:142192274
3084+c, tdbSNP:151193627
3087+a, gdbSNP:369406638
3170+a, gdbSNP:373201270
3176+a, cdbSNP:375063045
3214+c, gdbSNP:140321570
3230+c, tdbSNP:145566816
3231+a, gdbSNP:373493544
3243+c, tdbSNP:267605186
3249+a, gdbSNP:377267329
3281+a, gdbSNP:369597949
3305+a, gdbSNP:142295785
3334+g, tdbSNP:200985017
3352+a, gdbSNP:140544874
3379+c, gdbSNP:201528994
3494+c, tdbSNP:373264085
3495+a, gdbSNP:192082217
3529+c, tdbSNP:375939479
3530+a, gdbSNP:150396512
3533+c, tdbSNP:150875847
3572+a, gdbSNP:199547532
3595+a, gdbSNP:149162154
3597+a, gdbSNP:3744825
3658+c, tdbSNP:113314121
3684+a, cdbSNP:1064204
3717+a, gdbSNP:371402739
3777+c, gdbSNP:199578000
3807+a, cdbSNP:147540466
3840+c, tdbSNP:78016724
3857+c, tdbSNP:138530624
3862+a, gdbSNP:374624942
3872+c, tdbSNP:201826395
3889+c, tdbSNP:200960707
3890+a, gdbSNP:200032059
3894+c, gdbSNP:143448706
3896+a, gdbSNP:375838339
3911+a, gdbSNP:150509004
3914+c, tdbSNP:34882016
3917+g, tdbSNP:149695987
3928+a, gdbSNP:144471715
3941+c, tdbSNP:200219791
3977+a, gdbSNP:377760121
4007+c, tdbSNP:139317870
4008+a, gdbSNP:144087649
4027+a, gdbSNP:201474295
4075+c, tdbSNP:146524875
4086+g, tdbSNP:141108624
complement(4102)-g, adbSNP:79938638
4104+a, gdbSNP:142834327
4120+c, tdbSNP:151038663
4121+a, gdbSNP:8096662
4152+c, tdbSNP:150224800
4172+c, gdbSNP:139106261
4183+a, gdbSNP:369012871
4187+a, gdbSNP:141788618
4204+a, cdbSNP:147082972
4220+c, gdbSNP:138595519
4252+c, tdbSNP:372615623
4258+a, gdbSNP:149638556
4271+a, tdbSNP:192800556
4280+c, tdbSNP:199931480
4305+dbSNP:
4305+a, tdbSNP:144369581
4330+c, gdbSNP:148195272
4332+a, gdbSNP:141137185
4350+a, gdbSNP:146222882
4379+a, gdbSNP:201600296
4392+a, gdbSNP:145549368
4398+a, gdbSNP:370218399
4425+c, gdbSNP:77518617
4427+a, gdbSNP:35460875
4428+a, tdbSNP:374527037
4452+a, gdbSNP:200286369
4456+c, tdbSNP:200881888
4501+dbSNP:
4501+a, gdbSNP:371946489
4523+c, tdbSNP:200760583
4530+a, cdbSNP:145996171
4535+a, gdbSNP:200002988
4586+a, gdbSNP:139896661
4601+a, gdbSNP:368871445
4603+c, tdbSNP:373986368
4664+c, tdbSNP:149745878
4694+g, tdbSNP:117498128
4794+c, gdbSNP:200098271
4936+a, cdbSNP:201973930
4976+c, tdbSNP:201428338
5009+a, gdbSNP:369999882
5024+a, gdbSNP:372933465
5170+c, tdbSNP:182854123
5275+c, gdbSNP:143702938
5357+a, gdbSNP:372990506
5539+a, gdbSNP:151238478
5559+a, tdbSNP:1056570
5563+c, tdbSNP:1056571
5642..5643+, agttdbSNP:373620093
5823+, tdbSNP:368699262
5900+c, gdbSNP:7233404
5920+c, tdbSNP:73952954
5923+a, gdbSNP:187498930
5954+a, tdbSNP:191900502
6057+a, cdbSNP:376594750
6074+c, gdbSNP:184091282
6214+, adbSNP:57937684
6215..6216+, ggdbSNP:371727251
6250+a, gdbSNP:368967558
6458+c, tdbSNP:140436683
6600+c, tdbSNP:189265595
6620+c, tdbSNP:192597791
6730..6734+, gattadbSNP:370951422
6757+a, gdbSNP:185593899
6832+a, tdbSNP:73431734
6890..6891+, cdbSNP:34921199
6904+a, gdbSNP:9963575
7009+a, gdbSNP:190452303
7067+c, tdbSNP:372851027
7188+c, gdbSNP:377226573
7346+a, tdbSNP:1349385
7346+a, tdbSNP:111179711
7492+c, tdbSNP:149990348
7501+c, gdbSNP:373681388
7557+, adbSNP:34338523
complement(7638)-t, cdbSNP:145085946
7761+a, gdbSNP:57173867
7878+a, gdbSNP:142310022
7924+c, gdbSNP:181864816
complement(7949)-g, adbSNP:145912270
7971+c, tdbSNP:112813646
7987+a, gdbSNP:376381081
7988+a, cdbSNP:7244247
8043+c, tdbSNP:186026200
8053+, gdbSNP:150895395
8059..8060+, ttdbSNP:201439380
8059+, tdbSNP:34125334
8266+a, gdbSNP:72898811
8375+c, gdbSNP:146961449
8385+c, gdbSNP:371042311
8432+a, cdbSNP:115098550
8487..8488+, cdbSNP:34738582
8521+c, tdbSNP:148016914
8590+c, tdbSNP:188875989
8763+c, tdbSNP:117464906
8916+c, tdbSNP:141617886
8920+c, gdbSNP:181283064
8922+c, tdbSNP:112551826
8923+a, gdbSNP:373619763
8971+g, tdbSNP:117797575
9097+c, tdbSNP:150522461
9098+c, tdbSNP:138323876
9132+a, gdbSNP:376949450
9210+a, cdbSNP:186392177
9240+a, gdbSNP:190838021
9303+a, gdbSNP:182638330
9324+a, cdbSNP:143072709
9337+a, cdbSNP:77706244
9346..9347+, adbSNP:367680940
9412..9413+, adbSNP:35849833
9583+c, tdbSNP:146108802
9597+c, tdbSNP:76077260
9693+g, tdbSNP:140136345
9746+g, tdbSNP:187183455
9830+, adbSNP:10715988
Gene SymbolSETBP1
Gene SynonymSEB
Chromosome18
Locus Map18q21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_015559 Homo sapiens SET binding protein 1 (SETBP1), transcript variant 1, mRNA. On-demand TBD TBD
NM_001130110 Homo sapiens SET binding protein 1 (SETBP1), transcript variant 2, mRNA. In-stock $308.00 $259.00 10
XM_005258243 PREDICTED: Homo sapiens SET binding protein 1 (SETBP1), transcript variant X1, mRNA. On-demand TBD TBD
XM_005258244 PREDICTED: Homo sapiens SET binding protein 1 (SETBP1), transcript variant X2, mRNA. On-demand TBD TBD
XM_006722438 PREDICTED: Homo sapiens SET binding protein 1 (SETBP1), transcript variant X3, mRNA. On-demand $1699.00 25
Title Clinical implications of the SETBP1 mutation in patients with primary myelodysplastic syndrome and its stability during disease progression .
Author Hou HA, Kuo YY, Tang JL, Chou WC, Yao M, Lai YJ, Lin CC, Chen CY, Liu CY, Tseng MH, Huang CF, Chiang YC, Lee FY, Liu MC, Liu CW, Huang SY, Ko BS, Wu SJ, Tsay W, Chen YC and Tien HF.
Journal Am. J. Hematol. 89 (2), 181-186 (2014)
Title Mutations in SETBP1 are recurrent in myelodysplastic syndromes and often coexist with cytogenetic markers associated with disease progression .
Author Fernandez-Mercado M, Pellagatti A, Di Genua C, Larrayoz MJ, Winkelmann N, Aranaz P, Burns A, Schuh A, Calasanz MJ, Cross NC and Boultwood J.
Journal Br. J. Haematol. 163 (2), 235-239 (2013)
Title SETBP1 mutation analysis in 944 patients with MDS and AML .
Author Thol F, Suchanek KJ, Koenecke C, Stadler M, Platzbecker U, Thiede C, Schroeder T, Kobbe G, Kade S, Loffeld P, Banihosseini S, Bug G, Ottmann O, Hofmann WK, Krauter J, Kroger N, Ganser A and Heuser M.
Journal Leukemia 27 (10), 2072-2075 (2013)
Title Somatic SETBP1 mutations in myeloid malignancies .
Author Makishima H, Yoshida K, Nguyen N, Przychodzen B, Sanada M, Okuno Y, Ng KP, Gudmundsson KO, Vishwakarma BA, Jerez A, Gomez-Segui I, Takahashi M, Shiraishi Y, Nagata Y, Guinta K, Mori H, Sekeres MA, Chiba K, Tanaka H, Muramatsu H, Sakaguchi H, Paquette RL, McDevitt MA, Kojima S, Saunthararajah Y, Miyano S, Shih LY, Du Y, Ogawa S and Maciejewski JP.
Journal Nat. Genet. 45 (8), 942-946 (2013)
Title Exome sequencing identifies secondary mutations of SETBP1 and JAK3 in juvenile myelomonocytic leukemia .
Author Sakaguchi H, Okuno Y, Muramatsu H, Yoshida K, Shiraishi Y, Takahashi M, Kon A, Sanada M, Chiba K, Tanaka H, Makishima H, Wang X, Xu Y, Doisaki S, Hama A, Nakanishi K, Takahashi Y, Yoshida N, Maciejewski JP, Miyano S, Ogawa S and Kojima S.
Journal Nat. Genet. 45 (8), 937-941 (2013)
Title De novo mutations of SETBP1 cause Schinzel-Giedion syndrome .
Author Hoischen A, van Bon BW, Gilissen C, Arts P, van Lier B, Steehouwer M, de Vries P, de Reuver R, Wieskamp N, Mortier G, Devriendt K, Amorim MZ, Revencu N, Kidd A, Barbosa M, Turner A, Smith J, Oley C, Henderson A, Hayes IM, Thompson EM, Brunner HG, de Vries BB and Veltman JA.
Journal Nat. Genet. 42 (6), 483-485 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud PJ, Drenos F, Shah S, Shah T, Palmen J, Verzilli C, Gaunt TR, Pallas J, Lovering R, Li K, Casas JP, Sofat R, Kumari M, Rodriguez S, Johnson T, Newhouse SJ, Dominiczak A, Samani NJ, Caulfield M, Sever P, Stanton A, Shields DC, Padmanabhan S, Melander O, Hastie C, Delles C, Ebrahim S, Marmot MG, Smith GD, Lawlor DA, Munroe PB, Day IN, Kivimaki M, Whittaker J, Humphries SE and Hingorani AD.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Correction of X-linked chronic granulomatous disease by gene therapy, augmented by insertional activation of MDS1-EVI1, PRDM16 or SETBP1 .
Author Ott MG, Schmidt M, Schwarzwaelder K, Stein S, Siler U, Koehl U, Glimm H, Kuhlcke K, Schilz A, Kunkel H, Naundorf S, Brinkmann A, Deichmann A, Fischer M, Ball C, Pilz I, Dunbar C, Du Y, Jenkins NA, Copeland NG, Luthi U, Hassan M, Thrasher AJ, Hoelzer D, von Kalle C, Seger R and Grez M.
Journal Nat. Med. 12 (4), 401-409 (2006)
Title The human plasma proteome: a nonredundant list developed by combination of four separate sources .
Author Anderson NL, Polanski M, Pieper R, Gatlin T, Tirumalai RS, Conrads TP, Veenstra TD, Adkins JN, Pounds JG, Fagan R and Lobley A.
Journal Mol. Cell Proteomics 3 (4), 311-326 (2004)
Title Identification and characterization of SEB, a novel protein that binds to the acute undifferentiated leukemia-associated protein SET .
Author Minakuchi M, Kakazu N, Gorrin-Rivas MJ, Abe T, Copeland TD, Ueda K and Adachi Y.
Journal Eur. J. Biochem. 268 (5), 1340-1351 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.