• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28126 Homo sapiens transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu28126C Homo sapiens transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_015638.2, 41872428
Length 2394 bp
Structure linear
Update Date 15-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP), transcript variant 1, mRNA.
Product short transient receptor potential channel 4-associated protein isoform a
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BM149369.1, BC013144.1, BI488542.1, CF125531.1, BM723903.1 and BC008836.2. On Feb 3, 2004 this sequence version replaced gi:18158415.


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).

RefSeq NP_056453.1
CDS 35..2428
Misc Feature(1)38..1234
Misc Feature(2)38..1234
Misc Feature(3)38..40
Misc Feature(4)1253..2188
Exon (1)1..202
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (2)203..331
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (3)332..448
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (4)449..506
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (5)507..562
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (6)563..691
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (7)692..899
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (8)900..1085
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (9)1086..1252
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (10)1253..1384
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (11)1385..1443
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (12)1444..1545
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (13)1546..1629
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (14)1630..1720
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (15)1721..1861
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (16)1862..1970
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (17)1971..2083
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (18)2084..2290
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Exon (19)2291..3170
Gene:TRPC4AP
Gene Synonym:C20orf188; PPP1R158; TRRP4AP; TRUSS
Translation MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTET FLTERDKQSKWSGIPQLLLKLHTTSHLHSDFVECQNILKEISPLLSMEAMAFVTEERKLT QETTYPNTYIFDLFGGVDLLVEILMRPTISIRGQKLKISDEMSKDCLSILYNTCVCTEGV TKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKKEMIRLDEVPNLSSLVSNFDQQ QLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLGPSAAEINQAALLSIPGFVER LCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQASIVFPPPGA SEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGL NNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQE LNELSAISLKANIPEVEAVLNTDRSLVCDGKRGLLTRLLQVMKKEPAESSFRFWQARAVE SFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRF NKYINTDAKFQVFLKQINSSLVDSNMLVRCVTLSLDRFENQVDMKVAEVLSECRLLAYIS QVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLARRKERLPLYLRLLQRMEHSKK YPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENSSCISFSYWKETVSILLNPDRQSPSALV SYIEEPYMDIDRDFTEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(185)-g, adbSNP:113267371
complement(211)-dbSNP:
complement(211)-t, cdbSNP:139800499
complement(214)-g, adbSNP:200930585
complement(222)-g, adbSNP:200326780
complement(223)-t, cdbSNP:151054310
complement(224)-t, cdbSNP:139867118
complement(249)-t, cdbSNP:377286159
complement(268)-g, cdbSNP:143543424
complement(275)-t, gdbSNP:369640683
complement(309)-g, adbSNP:137879852
complement(319)-t, cdbSNP:112103992
complement(356)-dbSNP:
complement(356)-c, adbSNP:199888242
complement(400)-t, adbSNP:146932478
complement(421)-g, adbSNP:1998233
complement(443)-t, cdbSNP:370945652
complement(451)-dbSNP:
complement(451)-g, adbSNP:371142306
complement(477)-g, adbSNP:144708101
complement(478)-t, cdbSNP:150179620
complement(485)-t, cdbSNP:140817919
complement(500)-g, adbSNP:373295554
complement(504)-t, adbSNP:193203917
complement(511)-dbSNP:
complement(511)-t, adbSNP:377096923
complement(581)-dbSNP:
complement(581)-g, adbSNP:201809090
complement(616)-t, cdbSNP:200843794
complement(646)-t, gdbSNP:367589701
complement(666)-g, adbSNP:146490187
complement(701)-dbSNP:
complement(701)-g, adbSNP:374039578
complement(720)-t, cdbSNP:370558652
complement(736)-t, cdbSNP:377403157
complement(741)-t, cdbSNP:144262010
complement(745)-g, adbSNP:373043586
complement(752)-g, cdbSNP:140612284
complement(760)-g, adbSNP:202043337
complement(787)-g, cdbSNP:112677737
complement(811)-c, adbSNP:367845366
complement(850)-t, cdbSNP:146773849
complement(900)-dbSNP:
complement(900)-g, adbSNP:187038762
complement(901)-t, cdbSNP:199961940
complement(949)-t, cdbSNP:142266561
complement(954)-t, cdbSNP:201578373
complement(972)-g, adbSNP:201995082
complement(982)-g, adbSNP:372876419
complement(1026)-t, cdbSNP:369098171
complement(1027)-g, adbSNP:148729224
complement(1053)-c, adbSNP:181172530
complement(1062)-t, g, cdbSNP:144377533
complement(1064)-t, cdbSNP:150071144
complement(1128)-dbSNP:
complement(1128)-t, cdbSNP:140050862
complement(1140)-g, adbSNP:201037229
complement(1155)-t, gdbSNP:11905247
complement(1169)-t, cdbSNP:147516805
complement(1170)-g, adbSNP:182553395
complement(1184)-t, cdbSNP:143476570
complement(1216)-g, adbSNP:138023248
complement(1223)-t, cdbSNP:374664410
complement(1313)-dbSNP:
complement(1313)-g, adbSNP:190862131
complement(1400)-dbSNP:
complement(1400)-t, cdbSNP:369971393
complement(1474)-dbSNP:
complement(1474)-t, cdbSNP:367725575
complement(1490)-t, cdbSNP:374152361
complement(1507)-t, gdbSNP:199804934
complement(1512)-g, adbSNP:377569235
complement(1540)-g, adbSNP:201325275
complement(1541)-t, cdbSNP:376679194
complement(1574)-dbSNP:
complement(1574)-t, adbSNP:369325392
complement(1588)-t, cdbSNP:184368303
complement(1629)-t, cdbSNP:6120789
complement(1668)-dbSNP:
complement(1668)-t, cdbSNP:150756105
complement(1669)-t, cdbSNP:372696978
complement(1736)-dbSNP:
complement(1736)-t, cdbSNP:201234738
complement(1798)-t, cdbSNP:139975509
1822+a, tdbSNP:11552600
complement(1836)-t, cdbSNP:146015606
complement(1840)-t, cdbSNP:375964853
complement(1845)-g, adbSNP:14329
complement(1868)-dbSNP:
complement(1868)-g, cdbSNP:148201466
complement(1944)-t, cdbSNP:143166417
complement(1949)-g, cdbSNP:369793283
complement(1994)-dbSNP:
complement(1994)-g, adbSNP:371612752
complement(2003)-t, cdbSNP:367704685
complement(2025)-g, adbSNP:137973902
complement(2089)-dbSNP:
complement(2089)-g, adbSNP:145462116
complement(2098)-g, adbSNP:201107814
complement(2104)-g, adbSNP:202047781
complement(2145)-t, cdbSNP:140361914
complement(2150)-g, c, adbSNP:200035230
complement(2155)-g, cdbSNP:367754330
2174+c, tdbSNP:11552601
complement(2175)-t, cdbSNP:146813768
complement(2185)-g, adbSNP:371293020
complement(2200)-g, adbSNP:149805431
complement(2206)-g, adbSNP:140926257
complement(2212)-g, adbSNP:151041246
complement(2219)-g, adbSNP:142961539
complement(2221)-g, adbSNP:374488569
complement(2227)-g, adbSNP:200707079
complement(2254)-g, adbSNP:370841577
complement(2290)-g, adbSNP:368271092
complement(2300)-dbSNP:
complement(2300)-t, cdbSNP:140196281
complement(2320)-c, adbSNP:377753023
complement(2343)-t, cdbSNP:147499555
complement(2347)-t, cdbSNP:17092208
complement(2364)-g, cdbSNP:117729108
complement(2371)-g, adbSNP:118040773
complement(2372)-t, cdbSNP:201340281
complement(2380)-g, adbSNP:187807496
complement(2429)-g, adbSNP:369840973
complement(2462)-t, cdbSNP:199725379
complement(2467)-t, cdbSNP:185046445
complement(2470)-t, cdbSNP:376635360
complement(2473)-g, adbSNP:373376388
complement(2491)-g, adbSNP:201093403
complement(2551)-t, cdbSNP:140848050
complement(2639)-t, cdbSNP:192559769
complement(2709)-c, adbSNP:201797237
complement(2793)-t, c, adbSNP:8501
complement(2798..2799)-, atgdbSNP:375732962
complement(2799..2800)-, gdbSNP:150022394
complement(2807)-t, cdbSNP:112617727
complement(2853)-g, adbSNP:14206
complement(2960)-g, adbSNP:1058003
3019+a, c, gdbSNP:4616
complement(3063)-g, adbSNP:146419473
complement(3155..3156)-, agttdbSNP:371284276
Gene SymbolTRPC4AP
Gene SynonymC20orf188; PPP1R158; TRRP4AP; TRUSS
Chromosome20
Locus Map20q11.22
Title Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease .
Author Tang W, Schwienbacher C, Lopez LM, Ben-Shlomo Y, Oudot-Mellakh T, Johnson AD, Samani NJ, Basu S, Gogele M, Davies G, Lowe GD, Tregouet DA, Tan A, Pankow JS, Tenesa A, Levy D, Volpato CB, Rumley A, Gow AJ, Minelli C, Yarnell JW, Porteous DJ, Starr JM, Gallacher J, Boerwinkle E, Visscher PM, Pramstaller PP, Cushman M, Emilsson V, Plump AS, Matijevic N, Morange PE, Deary IJ, Hicks AA and Folsom AR.
Journal Am. J. Hum. Genet. 91 (1), 152-162 (2012)
Title TRUSS, TNF-R1, and TRPC ion channels synergistically reverse endoplasmic reticulum Ca2+ storage reduction in response to m1 muscarinic acetylcholine receptor signaling .
Author Mace KE, Lussier MP, Boulay G, Terry-Powers JL, Parfrey H, Perraud
Journal J. Cell. Physiol. 225 (2), 444-453 (2010)
Title Myc protein is stabilized by suppression of a novel E3 ligase complex in cancer cells .
Author Choi SH, Wright JB, Gerber SA and Cole MD.
Journal Genes Dev. 24 (12), 1236-1241 (2010)
Title Docking motif-guided mapping of the interactome of protein phosphatase-1 .
Author Hendrickx A, Beullens M, Ceulemans H, Den Abt T, Van Eynde A, Nicolaescu E, Lesage B and Bollen M.
Journal Chem. Biol. 16 (4), 365-371 (2009)
Title The frequency of the TRPC4AP haplotype in Alzheimer's patients .
Author Poduslo SE, Huang R and Huang J.
Journal Neurosci. Lett. 450 (3), 344-346 (2009)
Title Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones .
Author Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N and Ohara O.
Journal DNA Res. 10 (1), 49-57 (2003)
Title Interactions formed by individually expressed TAP1 and TAP2 polypeptide subunits .
Author Antoniou AN, Ford S, Pilley ES, Blake N and Powis SJ.
Journal Immunology 106 (2), 182-189 (2002)
Title The DNA sequence and comparative analysis of human chromosome 20 .
Author Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S and Rogers J.
Journal Nature 414 (6866), 865-871 (2001)
Title Structure of the ABC ATPase domain of human TAP1, the transporter associated with antigen processing .
Author Gaudet R and Wiley DC.
Journal EMBO J. 20 (17), 4964-4972 (2001)
Title Identification of sequences in the human peptide transporter subunit TAP1 required for transporter associated with antigen processing (TAP) function .
Author Ritz U, Momburg F, Pircher HP, Strand D, Huber C and Seliger B.
Journal Int. Immunol. 13 (1), 31-41 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.