• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu15670 Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu15670C Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_015981.3, 212549564
Length 1470 bp
Structure linear
Update Date 13-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA.
Product calcium/calmodulin-dependent protein kinase type II subunit alpha isoform 1
Comment

Summary: The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2008].


Transcript Variant: This variant (1) represents the longer transcript, and it encodes the longer protein (isoform 1).


Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_057065.2
CDS 216..1685
Misc Feature(1)45..47
Misc Feature(2)45..47
Misc Feature(3)252..1028
Misc Feature(4)252..1028
Misc Feature(5)270..1025
Misc Feature(6)order(270..284,294..296,333..335,339..341,432..434,
Misc Feature(7)order(270..284,294..296,333..335,339..341,432..434,
Misc Feature(8)order(282..284,501..503,507..509,618..620,624..626,
Misc Feature(9)order(678..701,729..749)
Misc Feature(10)1071..1073
Misc Feature(11)1083..1115
Misc Feature(12)1128..1130
Misc Feature(13)1284..1667
Exon (1)1..277
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (2)278..372
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (3)373..432
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (4)433..487
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (5)488..553
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (6)554..626
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (7)627..729
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (8)730..813
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (9)814..908
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (10)909..1031
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (11)1032..1115
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (12)1116..1158
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (13)1159..1199
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (14)1200..1232
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (15)1233..1281
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (16)1282..1357
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (17)1358..1452
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (18)1453..1681
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (19)1682..4904
Gene:CAMK2A
Gene Synonym:CAMKA
Translation MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR SGAPSVLPH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(113)-t, cdbSNP:114371823
complement(139)-g, adbSNP:149774361
complement(145)-g, adbSNP:112264872
complement(177)-t, gdbSNP:373285975
179+a, cdbSNP:11539000
complement(208)-c, adbSNP:184860162
complement(243)-t, adbSNP:6861622
complement(368)-dbSNP:
complement(368)-g, adbSNP:56178981
complement(370)-g, cdbSNP:202217757
complement(410)-dbSNP:
complement(410)-g, cdbSNP:55877006
complement(435)-dbSNP:
complement(435)-g, cdbSNP:61732056
complement(450)-t, cdbSNP:202107716
complement(479)-g, adbSNP:372258019
complement(482)-g, adbSNP:73268710
complement(518)-dbSNP:
complement(518)-g, adbSNP:373136765
complement(527)-t, cdbSNP:55856831
complement(545)-t, cdbSNP:200008559
complement(665)-dbSNP:
complement(665)-g, adbSNP:373461784
complement(677)-t, cdbSNP:370266511
complement(785)-dbSNP:
complement(785)-g, adbSNP:377296803
complement(788)-t, cdbSNP:373849502
complement(792)-g, cdbSNP:370600720
complement(871)-dbSNP:
complement(871)-t, adbSNP:11956781
complement(873..874)-, gggdbSNP:150670811
complement(882)-t, gdbSNP:17854002
complement(896)-g, adbSNP:201482484
complement(908)-t, adbSNP:368023327
complement(917)-dbSNP:
complement(917)-t, cdbSNP:371411676
complement(920)-t, cdbSNP:368367831
complement(941)-t, cdbSNP:186348077
complement(1004)-g, adbSNP:142245972
complement(1035)-dbSNP:
complement(1035)-g, adbSNP:200216623
complement(1050..1051)-, cdbSNP:35495165
complement(1142)-dbSNP:
complement(1142)-g, adbSNP:375270263
complement(1178)-dbSNP:
complement(1178)-g, adbSNP:55696902
complement(1187)-g, adbSNP:375813680
complement(1367)-dbSNP:
complement(1367)-g, adbSNP:375087065
complement(1406)-t, cdbSNP:371839355
complement(1452)-g, adbSNP:376699738
complement(1454)-dbSNP:
complement(1454)-t, cdbSNP:376988214
complement(1475)-g, adbSNP:373786921
complement(1490)-g, adbSNP:369670780
complement(1517)-g, adbSNP:376355423
complement(1535)-g, adbSNP:200745191
complement(1565)-g, adbSNP:373201434
complement(1566)-t, cdbSNP:374924411
complement(1569)-t, cdbSNP:199592588
complement(1583)-g, adbSNP:199578629
complement(1595)-t, cdbSNP:371342042
complement(1605)-g, adbSNP:367551385
complement(1610)-g, adbSNP:41287120
complement(1618)-t, cdbSNP:375918851
complement(1625)-g, adbSNP:2241694
complement(1643)-g, adbSNP:202174183
complement(1670)-g, adbSNP:192861753
complement(1707)-dbSNP:
complement(1707)-g, adbSNP:201811573
complement(1708)-t, cdbSNP:374575000
complement(1714)-t, cdbSNP:369901307
complement(1720)-g, adbSNP:150250733
complement(1729)-t, cdbSNP:372475680
complement(1733..1734)-, cadbSNP:61217791
complement(1734..1735)-, acdbSNP:140679603
complement(1737)-g, adbSNP:75000324
complement(1803)-g, adbSNP:141071420
complement(1829)-g, cdbSNP:151118217
complement(1855)-g, adbSNP:115797668
complement(1991)-g, adbSNP:112896997
complement(2024..2025)-, adbSNP:33920720
complement(2025..2026)-, tdbSNP:5872172
complement(2026..2027)-, cdbSNP:374563226
complement(2069)-t, cdbSNP:2217641
complement(2086)-g, cdbSNP:370722785
complement(2100)-g, adbSNP:184203395
complement(2130)-t, cdbSNP:957710
complement(2132)-t, cdbSNP:957709
complement(2162)-t, cdbSNP:376905162
complement(2190)-g, adbSNP:374631793
complement(2198)-t, cdbSNP:145916509
2218+a, gdbSNP:140231558
complement(2386)-g, cdbSNP:7448702
complement(2389)-t, gdbSNP:373456869
complement(2391)-c, adbSNP:371373892
2470+c, gdbSNP:1064129
complement(2520)-t, cdbSNP:79354200
complement(2629)-, adbSNP:35164363
complement(2646)-, cdbSNP:368118129
complement(2646)-c, adbSNP:201670618
complement(2693)-g, c, adbSNP:7732895
complement(2694)-t, cdbSNP:192111888
complement(2747)-t, adbSNP:143235845
complement(2757)-t, cdbSNP:187749277
complement(2902)-t, cdbSNP:184845639
complement(2931)-t, cdbSNP:35651593
complement(2947..2948)-, gdbSNP:34429496
complement(3011)-g, adbSNP:11952641
complement(3013)-g, cdbSNP:191193183
complement(3020)-t, cdbSNP:78265902
complement(3032..3033)-, cdbSNP:34864007
complement(3076)-t, cdbSNP:59633008
complement(3076)-g, adbSNP:386455381
complement(3103)-g, adbSNP:113163901
complement(3159)-g, adbSNP:187757305
complement(3274)-t, adbSNP:78529899
complement(3368)-g, adbSNP:112597831
complement(3406)-t, cdbSNP:182629016
complement(3413)-t, g, cdbSNP:72837583
complement(3439)-g, adbSNP:34266615
complement(3474)-g, cdbSNP:149933620
complement(3489)-t, cdbSNP:79207651
complement(3510)-t, cdbSNP:6869490
complement(3512)-g, adbSNP:370847074
complement(3553)-g, adbSNP:191256988
complement(3698..3699)-, gdbSNP:34655241
3714..3715+c, tdbSNP:1056039
complement(3728)-t, gdbSNP:187985136
complement(3791)-g, cdbSNP:183021002
complement(3882)-g, adbSNP:10038918
complement(3935)-g, adbSNP:190785277
complement(3991)-g, adbSNP:139169139
complement(3998)-g, adbSNP:186399006
complement(4104)-t, cdbSNP:111466577
complement(4117)-t, cdbSNP:73796375
complement(4156)-c, adbSNP:182017467
complement(4372)-g, adbSNP:116563155
complement(4410)-g, adbSNP:2163766
complement(4510..4511)-, tdbSNP:376082789
complement(4510..4511)-, tdbSNP:386405299
complement(4511..4512)-, tdbSNP:386405298
complement(4512..4513)-, tdbSNP:34777554
complement(4521..4522)-, tdbSNP:138971440
complement(4522..4524)-, ttadbSNP:147490193
complement(4535..4536)-, attdbSNP:57339321
complement(4584)-g, adbSNP:6882623
complement(4734)-c, adbSNP:15645
complement(4743..4744)-, adbSNP:397724114
complement(4750..4766)-, aaaaaagaaaagaaaaadbSNP:200240393
complement(4753..4754)-, adbSNP:11398735
complement(4755)-g, adbSNP:111509060
complement(4790)-t, adbSNP:192040695
complement(4820)-t, cdbSNP:13173132
complement(4822)-c, adbSNP:6882312
4823+a, g, tdbSNP:1056045
complement(4824)-c, adbSNP:7721896
complement(4825)-g, cdbSNP:200391443
complement(4826..4827)-, gcdbSNP:375452482
complement(4827..4829)-, ccgdbSNP:199517991
complement(4827..4828)-, cgdbSNP:138156987
complement(4827)-, gdbSNP:10609501
complement(4827)-g, cdbSNP:113096177
complement(4830..4831)-, ccdbSNP:199658748
complement(4831..4832)-, cadbSNP:370321137
complement(4842)-t, cdbSNP:10038061
complement(4845)-t, cdbSNP:10038060
complement(4849)-t, gdbSNP:375378601
complement(4850)-t, cdbSNP:114959506
complement(4867)-c, adbSNP:10043606
4890+c, tdbSNP:147430614
Gene SymbolCAMK2A
Gene SynonymCAMKA
Chromosome5
Locus Map5q32
Title alphaCaMKII autophosphorylation controls the establishment of alcohol drinking behavior .
Author Easton AC, Lucchesi W, Lourdusamy A, Lenz B, Solati J, Golub Y, Lewczuk P, Fernandes C, Desrivieres S, Dawirs RR, Moll GH, Kornhuber J, Frank J, Hoffmann P, Soyka M, Kiefer F, Schumann G, Peter Giese K, Muller CP, Treutlein J, Cichon S, Ridinger M, Mattheisen P, Herms S, Wodarz N, Zill P, Maier W, Mossner R, Gaebel W, Dahmen N, Scherbaum N, Schmal C, Steffens M, Lucae S, Ising M, Muller-Myhsok B, Nothen MM, Mann K and Rietschel M.
Journal Neuropsychopharmacology 38 (9), 1636-1647 (2013)
Title CAMK2A polymorphisms predict working memory performance in humans .
Author Easton,A.C., Lourdusamy,A., Loth,E., Toro,R., Giese,K.P., Kornhuber,J., de Quervain,D.J., Papassotiropoulos,A., Fernandes,C., Muller,C.P. and Schumann,G.
Journal Mol. Psychiatry 18 (8), 850-852 (2013)
Title Calmodulin-dependent kinase II regulates osteoblast differentiation through regulation of Osterix .
Author Choi YH, Choi JH, Oh JW and Lee KY.
Journal Biochem. Biophys. Res. Commun. 432 (2), 248-255 (2013)
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title Activity-dependent subcellular cotrafficking of the small GTPase Rem2 and Ca2+/CaM-dependent protein kinase IIalpha .
Author Flynn R, Labrie-Dion E, Bernier N, Colicos MA, De Koninck P and Zamponi GW.
Journal PLoS ONE 7 (7), E41185 (2012)
Title Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites .
Author Bredt DS, Ferris CD and Snyder SH.
Journal J. Biol. Chem. 267 (16), 10976-10981 (1992)
Title PKC epsilon-related kinase associates with and phosphorylates cytokeratin 8 and 18 .
Author Omary MB, Baxter GT, Chou CF, Riopel CL, Lin WY and Strulovici B.
Journal J. Cell Biol. 117 (3), 583-593 (1992)
Title Calcium-regulated phosphorylation within the leucine zipper of C/EBP beta .
Author Wegner M, Cao Z and Rosenfeld MG.
Journal Science 256 (5055), 370-373 (1992)
Title Mechanism of desensitization of the epidermal growth factor receptor protein-tyrosine kinase .
Author Countaway JL, Nairn AC and Davis RJ.
Journal J. Biol. Chem. 267 (2), 1129-1140 (1992)
Title Ca2(+)-calmodulin-dependent protein kinase II phosphorylates various types of non-epithelial intermediate filament proteins .
Author Tokui T, Yamauchi T, Yano T, Nishi Y, Kusagawa M, Yatani R and Inagaki M.
Journal Biochem. Biophys. Res. Commun. 169 (3), 896-904 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.