• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_015981 Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA. ORF Sequence $426.30
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_015981.3, 212549564
Length 4918 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA.
Product calcium/calmodulin-dependent protein kinase type II subunit alpha isoform 1
Comment

Summary: The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2008].


Transcript Variant: This variant (1) represents the longer transcript, and it encodes the longer protein (isoform 1).


Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_057065.2
CDS 216..1685
Misc Feature(1)45..47
Misc Feature(2)45..47
Misc Feature(3)252..1028
Misc Feature(4)252..1028
Misc Feature(5)270..1025
Misc Feature(6)order(270..284,294..296,333..335,339..341,432..434,
Misc Feature(7)order(270..284,294..296,333..335,339..341,432..434,
Misc Feature(8)order(282..284,501..503,507..509,618..620,624..626,
Misc Feature(9)order(678..701,729..749)
Misc Feature(10)1071..1073
Misc Feature(11)1083..1115
Misc Feature(12)1128..1130
Misc Feature(13)1284..1667
Exon (1)1..277
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (2)278..372
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (3)373..432
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (4)433..487
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (5)488..553
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (6)554..626
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (7)627..729
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (8)730..813
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (9)814..908
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (10)909..1031
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (11)1032..1115
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (12)1116..1158
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (13)1159..1199
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (14)1200..1232
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (15)1233..1281
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (16)1282..1357
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (17)1358..1452
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (18)1453..1681
Gene:CAMK2A
Gene Synonym:CAMKA
Exon (19)1682..4904
Gene:CAMK2A
Gene Synonym:CAMKA
Translation MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR SGAPSVLPH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(113)-t, cdbSNP:114371823
complement(139)-g, adbSNP:149774361
complement(145)-g, adbSNP:112264872
complement(179)-c, adbSNP:11539000
complement(208)-c, adbSNP:184860162
complement(243)-t, adbSNP:6861622
complement(368)-dbSNP:
complement(368)-g, adbSNP:56178981
complement(370)-g, cdbSNP:202217757
complement(410)-dbSNP:
complement(410)-g, cdbSNP:55877006
complement(435)-dbSNP:
complement(435)-g, cdbSNP:61732056
complement(450)-t, cdbSNP:202107716
complement(482)-g, adbSNP:73268710
complement(527)-dbSNP:
complement(527)-t, cdbSNP:55856831
complement(545)-t, cdbSNP:200008559
complement(871)-dbSNP:
complement(871)-t, adbSNP:11956781
complement(875..876)-, gggdbSNP:150670811
complement(882)-t, gdbSNP:17854002
complement(896)-g, adbSNP:201482484
complement(941)-dbSNP:
complement(941)-t, cdbSNP:186348077
complement(1004)-g, adbSNP:142245972
complement(1035)-dbSNP:
complement(1035)-g, adbSNP:200216623
complement(1050..1051)-, cdbSNP:35495165
complement(1116..1117)-dbSNP:
complement(1116..1117)-, cdbSNP:34518883
complement(1178)-dbSNP:
complement(1178)-g, adbSNP:55696902
complement(1535)-dbSNP:
complement(1535)-g, adbSNP:200745191
complement(1569)-t, cdbSNP:199592588
complement(1583)-g, adbSNP:199578629
complement(1610)-g, adbSNP:41287120
complement(1625)-g, adbSNP:2241694
complement(1643)-g, adbSNP:202174183
complement(1670)-g, adbSNP:192861753
complement(1707)-dbSNP:
complement(1707)-g, adbSNP:201811573
complement(1720)-g, adbSNP:150250733
complement(1733..1734)-, cadbSNP:61217791
complement(1734..1735)-, acdbSNP:140679603
complement(1737)-g, adbSNP:75000324
complement(1803)-g, adbSNP:141071420
complement(1829)-g, cdbSNP:151118217
complement(1855)-g, adbSNP:115797668
complement(1991)-g, adbSNP:112896997
complement(2024..2025)-, adbSNP:33920720
complement(2026..2027)-, tdbSNP:5872172
complement(2069)-t, cdbSNP:2217641
complement(2100)-g, adbSNP:184203395
complement(2130)-t, cdbSNP:957710
complement(2132)-t, cdbSNP:957709
complement(2198)-t, cdbSNP:145916509
complement(2218)-g, adbSNP:140231558
complement(2386)-g, cdbSNP:7448702
complement(2470)-g, cdbSNP:1064129
complement(2520)-t, cdbSNP:79354200
complement(2639)-, a, aadbSNP:67275735
complement(2645)-, adbSNP:35164363
complement(2646)-c, adbSNP:201670618
complement(2693)-g, c, adbSNP:7732895
complement(2694)-t, cdbSNP:192111888
complement(2747)-t, adbSNP:143235845
complement(2757)-t, cdbSNP:187749277
complement(2902)-t, cdbSNP:184845639
complement(2931)-t, cdbSNP:35651593
complement(2952..2953)-, gdbSNP:34429496
complement(3011)-g, adbSNP:11952641
complement(3013)-g, cdbSNP:191193183
complement(3020)-t, cdbSNP:78265902
complement(3034..3035)-, cdbSNP:34864007
complement(3076)-t, cdbSNP:59633008
complement(3103)-g, adbSNP:113163901
complement(3159)-g, adbSNP:187757305
complement(3274)-t, adbSNP:78529899
complement(3368)-g, adbSNP:112597831
complement(3406)-t, cdbSNP:182629016
complement(3413)-t, g, cdbSNP:72837583
complement(3439)-g, adbSNP:34266615
complement(3474)-g, cdbSNP:149933620
complement(3489)-t, cdbSNP:79207651
complement(3510)-t, cdbSNP:6869490
complement(3553)-g, adbSNP:191256988
complement(3701..3702)-, gdbSNP:34655241
complement(3715)-t, cdbSNP:1056039
complement(3728)-t, gdbSNP:187985136
complement(3791)-g, cdbSNP:183021002
complement(3882)-g, adbSNP:10038918
complement(3935)-g, adbSNP:190785277
complement(3991)-g, adbSNP:139169139
complement(3998)-g, adbSNP:186399006
complement(4104)-t, cdbSNP:111466577
complement(4117)-t, cdbSNP:73796375
complement(4156)-c, adbSNP:182017467
complement(4372)-g, adbSNP:116563155
complement(4410)-g, adbSNP:2163766
complement(4511..4512)-, tdbSNP:67700842
complement(4512..4513)-, tdbSNP:200391594
complement(4512..4513)-, t, attattdbSNP:34777554
complement(4519)-, attattdbSNP:33970690
complement(4522..4524)-, ttadbSNP:147490193
complement(4522)-, attdbSNP:71757165
complement(4524..4525)-, tdbSNP:138971440
complement(4524)-, ttadbSNP:71679007
complement(4535..4536)-, attdbSNP:57339321
complement(4584)-g, adbSNP:6882623
complement(4734)-c, adbSNP:15645
complement(4750..4766)-, aaaaaagaaaagaaaaadbSNP:200240393
complement(4753..4754)-, adbSNP:11398735
complement(4755)-g, adbSNP:111509060
complement(4758..4759)-, adbSNP:111921214
complement(4790)-t, adbSNP:192040695
complement(4820)-t, cdbSNP:13173132
complement(4822)-c, adbSNP:6882312
complement(4823)-t, g, adbSNP:1056045
complement(4824)-c, adbSNP:7721896
complement(4825)-g, cdbSNP:200391443
complement(4827..4829)-, ccgdbSNP:199517991
complement(4827..4828)-, cgdbSNP:138156987
complement(4827)-, g, cg, gcdbSNP:10609501
complement(4827)-g, cdbSNP:113096177
complement(4830..4831)-, ccdbSNP:199658748
complement(4842)-t, cdbSNP:10038061
complement(4845)-t, cdbSNP:10038060
complement(4850)-t, cdbSNP:114959506
complement(4867)-c, adbSNP:10043606
complement(4890)-t, cdbSNP:147430614
Gene SymbolCAMK2A
Gene SynonymCAMKA
Chromosome5
Locus Map5q32
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_015981 Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, mRNA. Full Length $1721.30
ORF Sequence $426.30
NM_171825 Homo sapiens calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 2, mRNA. Full Length $1709.75
ORF Sequence $416.73
Title The role of CaMKII in regulating GLUT4 expression in skeletal muscle .
Author Ojuka,E.O., Goyaram,V. and Smith,J.A.
Journal Am. J. Physiol. Endocrinol. Metab. 303 (3), E322-E331 (2012)
Title Impaired calcium calmodulin kinase signaling and muscle adaptation response in the absence of calpain 3 .
Author Kramerova,I., Kudryashova,E., Ermolova,N., Saenz,A., Jaka,O., Lopez de Munain,A. and Spencer,M.J.
Journal Hum. Mol. Genet. 21 (14), 3193-3204 (2012)
Title AMPAR-independent effect of striatal alphaCaMKII promotes the sensitization of cocaine reward .
Author Kourrich,S., Klug,J.R., Mayford,M. and Thomas,M.J.
Journal J. Neurosci. 32 (19), 6578-6586 (2012)
Title Substrate-selective and calcium-independent activation of CaMKII by alpha-actinin .
Author Jalan-Sakrikar,N., Bartlett,R.K., Baucum,A.J. II and Colbran,R.J.
Journal J. Biol. Chem. 287 (19), 15275-15283 (2012)
Title Activity-dependent subcellular cotrafficking of the small GTPase Rem2 and Ca2+/CaM-dependent protein kinase IIalpha .
Author Flynn,R., Labrie-Dion,E., Bernier,N., Colicos,M.A., De Koninck,P. and Zamponi,G.W.
Journal PLoS ONE 7 (7), E41185 (2012)
Title Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites .
Author Bredt,D.S., Ferris,C.D. and Snyder,S.H.
Journal J. Biol. Chem. 267 (16), 10976-10981 (1992)
Title PKC epsilon-related kinase associates with and phosphorylates cytokeratin 8 and 18 .
Author Omary,M.B., Baxter,G.T., Chou,C.F., Riopel,C.L., Lin,W.Y. and Strulovici,B.
Journal J. Cell Biol. 117 (3), 583-593 (1992)
Title Calcium-regulated phosphorylation within the leucine zipper of C/EBP beta .
Author Wegner,M., Cao,Z. and Rosenfeld,M.G.
Journal Science 256 (5055), 370-373 (1992)
Title Mechanism of desensitization of the epidermal growth factor receptor protein-tyrosine kinase .
Author Countaway,J.L., Nairn,A.C. and Davis,R.J.
Journal J. Biol. Chem. 267 (2), 1129-1140 (1992)
Title Ca2(+)-calmodulin-dependent protein kinase II phosphorylates various types of non-epithelial intermediate filament proteins .
Author Tokui,T., Yamauchi,T., Yano,T., Nishi,Y., Kusagawa,M., Yatani,R. and Inagaki,M.
Journal Biochem. Biophys. Res. Commun. 169 (3), 896-904 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878