• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adiponectin receptor 1 (ADIPOR1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23300 Homo sapiens adiponectin receptor 1 (ADIPOR1), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu23300C Homo sapiens adiponectin receptor 1 (ADIPOR1), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_015999.5, 594952022
Length 1128 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens adiponectin receptor 1 (ADIPOR1), transcript variant 1, mRNA.
Product adiponectin receptor protein 1
Comment

Summary: This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014].


Transcript Variant: This variant (1, also known as R1T1) is a predominant transcript. All variants encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_057083.2
CDS 307..1434
Misc Feature(1)292..294
Misc Feature(2)691..1362
Misc Feature(3)691..1362
Misc Feature(4)715..777
Misc Feature(5)817..879
Misc Feature(6)934..996
Misc Feature(7)1012..1074
Misc Feature(8)1108..1170
Misc Feature(9)1195..1257
Misc Feature(10)1300..1362
Exon (1)1..212
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Exon (2)213..447
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Exon (3)448..564
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Exon (4)565..736
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Exon (5)737..923
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Exon (6)924..1111
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Exon (7)1112..1305
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Exon (8)1306..2182
Gene:ADIPOR1
Gene Synonym:ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Translation MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE FRYGLEGGCTDDTLL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(10)-dbSNP:
complement(10)-g, adbSNP:370168230
complement(18)-t, cdbSNP:7517286
complement(24)-t, cdbSNP:7529354
complement(82)-t, cdbSNP:370533048
complement(89)-g, adbSNP:377656058
complement(220)-dbSNP:
complement(220)-t, gdbSNP:113872820
complement(247)-t, cdbSNP:181500248
complement(261)-t, gdbSNP:200601546
complement(288)-t, cdbSNP:75750763
complement(341)-t, cdbSNP:372656012
complement(347)-c, adbSNP:200868442
complement(377)-g, adbSNP:369139073
complement(378)-t, cdbSNP:371808180
complement(388)-t, cdbSNP:149582032
complement(417)-t, cdbSNP:146026266
complement(425)-g, cdbSNP:369660216
complement(432)-g, adbSNP:375847149
complement(438)-g, adbSNP:34357845
complement(501)-dbSNP:
complement(501)-t, cdbSNP:367734278
complement(531)-g, adbSNP:150127027
complement(578)-dbSNP:
complement(578)-t, cdbSNP:200676846
complement(593)-g, adbSNP:141511034
complement(594)-t, cdbSNP:377378130
complement(627)-g, adbSNP:377163409
699+c, tdbSNP:1043213
complement(702)-g, adbSNP:141706866
complement(780)-dbSNP:
complement(780)-t, cdbSNP:146792118
complement(789)-t, cdbSNP:373089230
complement(960)-dbSNP:
complement(960)-t, cdbSNP:372980347
complement(976)-g, adbSNP:200326086
997+a, gdbSNP:75992419
complement(1002)-t, gdbSNP:74411226
complement(1058)-t, adbSNP:369530077
complement(1064)-g, adbSNP:143634072
complement(1065)-t, cdbSNP:145759019
complement(1128)-dbSNP:
complement(1128)-g, adbSNP:376585520
complement(1141)-t, cdbSNP:372159963
complement(1191)-g, cdbSNP:139792596
complement(1193)-g, cdbSNP:374623170
complement(1226)-g, adbSNP:12072660
complement(1308)-dbSNP:
complement(1308)-g, adbSNP:144099149
complement(1325..1326)-, gdbSNP:34474966
complement(1395)-g, adbSNP:370136601
complement(1396)-t, cdbSNP:139371614
complement(1448)-g, adbSNP:61822676
complement(1449)-t, cdbSNP:372794101
complement(1469)-g, adbSNP:377103417
complement(1489)-c, adbSNP:137995793
complement(1530)-g, adbSNP:186721055
complement(1546)-, tdbSNP:375885393
complement(1652)-t, gdbSNP:117755738
complement(1678)-g, adbSNP:181259491
complement(1679)-t, cdbSNP:114825641
complement(1743)-g, adbSNP:370317002
1804+a, gdbSNP:146219634
complement(1817)-t, cdbSNP:10581
1869+a, cdbSNP:1043268
1907+c, tdbSNP:1043280
1948+a, cdbSNP:8167
complement(1948)-c, adbSNP:386615702
complement(1957)-g, adbSNP:113890019
complement(2014)-t, adbSNP:80165154
complement(2026)-g, adbSNP:11547945
complement(2075)-t, adbSNP:112936913
complement(2126)-t, cdbSNP:189663347
complement(2161)-g, cdbSNP:7539542
Gene SymbolADIPOR1
Gene SynonymACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Chromosome1
Locus Map1q32.1
Title Underactivation of the adiponectin-adiponectin receptor 1 axis in clear cell renal cell carcinoma: implications for progression .
Author Kleinmann N, Duivenvoorden WC, Hopmans SN, Beatty LK, Qiao S, Gallino D, Lhotak S, Daya D, Paschos A, Austin RC and Pinthus JH.
Journal Clin. Exp. Metastasis 31 (2), 169-183 (2014)
Title Adiponectin receptors are present in RANK-L-induced multinucleated osteoclast-like cells .
Author Pacheco-Pantoja EL, Waring VJ, Wilson PJ, Fraser WD and Gallagher JA.
Journal J. Recept. Signal Transduct. Res. 33 (5), 291-297 (2013)
Title Clinical and genetic predictors of weight gain in patients diagnosed with breast cancer .
Author Reddy SM, Sadim M, Li J, Yi N, Agarwal S, Mantzoros CS and Kaklamani VG.
Journal Br. J. Cancer 109 (4), 872-881 (2013)
Title Expression of adiponectin and its receptors in type 1 diabetes mellitus in human and mouse retinas .
Author Lin T, Qiu Y, Liu Y, Mohan R, Li Q and Lei B.
Journal Mol. Vis. 19, 1769-1778 (2013)
Title Differential expression of novel adiponectin receptor-1 transcripts in skeletal muscle of subjects with normal glucose tolerance and type 2 diabetes .
Author Ashwal R, Hemi R, Tirosh A, Gordin R, Yissachar E, Cohen-Dayag A, Rosenberg A, Karasik A, Bluher M and Kanety H.
Journal Diabetes 60 (3), 936-946 (2011)
Title Expression of adiponectin receptor mRNA in human skeletal muscle cells is related to in vivo parameters of glucose and lipid metabolism .
Author Staiger H, Kaltenbach S, Staiger K, Stefan N, Fritsche A, Guirguis A, Peterfi C, Weisser M, Machicao F, Stumvoll M and Haring HU.
Journal Diabetes 53 (9), 2195-2201 (2004)
Title Adiponectin receptor 1 gene (ADIPOR1) as a candidate for type 2 diabetes and insulin resistance .
Author Wang H, Zhang H, Jia Y, Zhang Z, Craig R, Wang X and Elbein SC.
Journal Diabetes 53 (8), 2132-2136 (2004)
Title Adiponectin receptors gene expression and insulin sensitivity in non-diabetic Mexican Americans with or without a family history of Type 2 diabetes .
Author Civitarese AE, Jenkinson CP, Richardson D, Bajaj M, Cusi K, Kashyap S, Berria R, Belfort R, DeFronzo RA, Mandarino LJ and Ravussin E.
Journal Diabetologia 47 (5), 816-820 (2004)
Title Expression of adiponectin receptors in pancreatic beta cells .
Author Kharroubi I, Rasschaert J, Eizirik DL and Cnop M.
Journal Biochem. Biophys. Res. Commun. 312 (4), 1118-1122 (2003)
Title Cloning of adiponectin receptors that mediate antidiabetic metabolic effects .
Author Yamauchi T, Kamon J, Ito Y, Tsuchida A, Yokomizo T, Kita S, Sugiyama T, Miyagishi M, Hara K, Tsunoda M, Murakami K, Ohteki T, Uchida S, Takekawa S, Waki H, Tsuno NH, Shibata Y, Terauchi Y, Froguel P, Tobe K, Koyasu S, Taira K, Kitamura T, Shimizu T, Nagai
Journal Nature 423 (6941), 762-769 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.