• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu41601 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu41601C Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_016203.3, 100913190
Length 1710 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA.
Product 5'-AMP-activated protein kinase subunit gamma-2 isoform a
Comment

Summary: AMP-activated protein kinase (AMPK) is a heterotrimeric protein composed of a catalytic alpha subunit, a noncatalytic beta subunit, and a noncatalytic regulatory gamma subunit. Various forms of each of these subunits exist, encoded by different genes. AMPK is an important energy-sensing enzyme that monitors cellular energy status and functions by inactivating key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This gene is a member of the AMPK gamma subunit family and encodes a protein with four cystathionine beta-synthase domains. Mutations in this gene have been associated with ventricular pre-excitation (Wolff-Parkinson-White syndrome), progressive conduction system disease and cardiac hypertrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (a) represents the longest transcript and encodes the longest isoform (a, also referred to as PRKAG2-a).

RefSeq NP_057287.2
CDS 612..2321
Misc Feature(1)405..407
Misc Feature(2)1080..1082
Misc Feature(3)1080..1082
Misc Feature(4)1095..1097
Misc Feature(5)1110..1112
Misc Feature(6)1443..1832
Misc Feature(7)1686..2048
Misc Feature(8)1719..1784
Misc Feature(9)1911..2270
Misc Feature(10)1914..2264
Exon (1)1..725
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (2)726..797
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (3)798..1077
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (4)1078..1295
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (5)1296..1365
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (6)1366..1475
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (7)1476..1557
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (8)1558..1616
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (9)1617..1662
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (10)1663..1717
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (11)1718..1844
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (12)1845..2010
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (13)2011..2048
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (14)2049..2195
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (15)2196..2289
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (16)2290..3408
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Translation MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS IVGIISLSDILQALILTPAGAKQKETETE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-dbSNP:
complement(52)-g, adbSNP:117728810
complement(92)-g, adbSNP:73160072
complement(131)-t, cdbSNP:373697168
complement(257)-g, cdbSNP:113257361
complement(274)-t, cdbSNP:73728442
290+a, gdbSNP:142348760
complement(325)-g, cdbSNP:75059373
complement(344)-g, cdbSNP:190746984
complement(446..448)-, gccdbSNP:372738203
complement(522)-c, adbSNP:76351165
complement(572)-g, adbSNP:148715621
complement(586)-g, adbSNP:66628686
complement(596)-t, cdbSNP:200468798
complement(611)-g, adbSNP:370949737
627+a, tdbSNP:3207363
complement(651)-g, cdbSNP:150188173
complement(653)-t, adbSNP:141316327
complement(667)-t, cdbSNP:368522976
complement(670)-c, adbSNP:116605521
complement(717)-g, adbSNP:377603922
complement(722)-t, adbSNP:144426409
725+a, gdbSNP:397517261
complement(730)-dbSNP:
complement(730)-t, adbSNP:139653890
734+c, tdbSNP:397517263
complement(741)-t, cdbSNP:144857453
complement(745)-t, adbSNP:181839504
complement(748)-g, adbSNP:373477232
complement(776)-g, adbSNP:202056358
777+a, gdbSNP:397517266
complement(797)-c, adbSNP:369687307
complement(806)-dbSNP:
complement(806)-, gdbSNP:36010423
complement(817)-g, adbSNP:182750960
complement(818)-t, cdbSNP:144384573
complement(835)-g, cdbSNP:199963585
complement(851)-t, gdbSNP:142482217
complement(856)-t, cdbSNP:368871685
complement(858)-g, adbSNP:148791216
complement(861)-g, adbSNP:61746358
complement(862)-t, cdbSNP:201953758
complement(886)-t, gdbSNP:375398155
complement(909)-t, cdbSNP:79474211
923+c, tdbSNP:397517268
924+a, gdbSNP:397517269
complement(929)-g, adbSNP:373277092
complement(936)-c, adbSNP:139579816
complement(952)-g, adbSNP:375174733
complement(953)-t, cdbSNP:147365679
complement(958)-c, adbSNP:369471907
complement(961)-g, adbSNP:372433693
complement(967)-t, cdbSNP:142808871
complement(998)-g, adbSNP:138610896
1036+c, tdbSNP:397517270
1039+c, tdbSNP:397517271
complement(1042)-g, adbSNP:150140412
complement(1082)-dbSNP:
complement(1082)-g, adbSNP:141804012
complement(1132)-g, adbSNP:148056866
complement(1142)-c, adbSNP:373000537
1143+a, gdbSNP:397517273
1165+a, tdbSNP:397517274
complement(1167)-g, adbSNP:200392688
complement(1168)-t, cdbSNP:145006140
complement(1179)-g, adbSNP:202200501
complement(1181)-g, adbSNP:141191531
complement(1186)-t, cdbSNP:146578426
complement(1192)-g, adbSNP:145669999
complement(1198)-g, adbSNP:267601424
complement(1201)-g, cdbSNP:368637364
1204..1205+, cdbSNP:397517275
1204+c, tdbSNP:41317142
1205+a, gdbSNP:397517276
complement(1212)-c, adbSNP:148952775
complement(1228)-g, adbSNP:182084936
complement(1229)-t, c, adbSNP:145827515
1231+c, gdbSNP:397517277
complement(1238)-g, adbSNP:201850057
complement(1247)-t, cdbSNP:149820808
complement(1250)-g, adbSNP:140001300
complement(1270)-g, adbSNP:200181419
complement(1295)-g, adbSNP:151108625
complement(1309)-dbSNP:
complement(1309)-g, cdbSNP:201240745
complement(1323)-t, cdbSNP:200736454
1333+a, gdbSNP:397517280
1350+c, gdbSNP:397517281
complement(1361)-g, adbSNP:201735117
complement(1399)-dbSNP:
complement(1399)-t, cdbSNP:368244224
complement(1421)-g, adbSNP:61752000
1476+dbSNP:
1476+a, gdbSNP:397517282
1490+a, cdbSNP:193922697
complement(1508)-g, adbSNP:201876556
1516+a, gdbSNP:121908987
complement(1523)-t, cdbSNP:145029525
1578+dbSNP:
1578+a, tdbSNP:397517283
complement(1601)-g, adbSNP:200919184
1604+c, tdbSNP:397517284
1682+dbSNP:
1682+a, tdbSNP:397517260
complement(1709)-t, cdbSNP:116541276
1759+dbSNP:
1759+a, gdbSNP:121908988
1763+a, tdbSNP:397517262
complement(1772)-g, adbSNP:189673596
1810+a, cdbSNP:28938173
complement(1866)-dbSNP:
complement(1866)-t, cdbSNP:373919593
complement(1878)-t, gdbSNP:147349145
complement(1907)-t, cdbSNP:114079815
complement(1915)-t, cdbSNP:200589374
complement(1926)-t, cdbSNP:370257703
complement(1929)-g, adbSNP:201878539
complement(1935)-t, cdbSNP:199863116
2001+a, gdbSNP:397517264
2051+dbSNP:
2051+c, tdbSNP:397517265
complement(2060)-g, adbSNP:148632949
2070+c, tdbSNP:267606976
2074+a, tdbSNP:121908989
complement(2086)-t, adbSNP:186114650
complement(2090)-t, cdbSNP:367768776
complement(2113)-t, cdbSNP:144077131
2127+c, gdbSNP:267606978
complement(2140)-t, cdbSNP:370899599
complement(2171)-t, gdbSNP:376762359
complement(2175)-c, adbSNP:199985555
2200+dbSNP:
2200+a, gdbSNP:267606977
2202+c, gdbSNP:121908990
2203+a, g, tdbSNP:121908991
complement(2204)-t, cdbSNP:148197254
complement(2209)-c, adbSNP:201542789
complement(2212)-c, adbSNP:200300797
complement(2215)-c, adbSNP:79091144
complement(2225)-t, cdbSNP:368852903
2234+c, tdbSNP:28763998
2253+c, tdbSNP:267606979
complement(2255)-t, cdbSNP:376450705
complement(2270)-g, adbSNP:374476363
complement(2292)-dbSNP:
complement(2292)-t, cdbSNP:61744760
2298+c, tdbSNP:397517267
complement(2315)-t, cdbSNP:138167675
complement(2323)-g, adbSNP:199559205
complement(2324)-t, cdbSNP:113234987
complement(2327)-t, cdbSNP:181109799
complement(2338)-g, adbSNP:370121696
complement(2364)-t, cdbSNP:368963259
complement(2376)-g, adbSNP:371637024
complement(2377)-t, cdbSNP:141781827
complement(2397)-t, cdbSNP:374537183
complement(2433)-t, cdbSNP:8961
complement(2442)-c, adbSNP:373597487
complement(2448)-g, cdbSNP:189787963
complement(2456)-g, adbSNP:184932311
2477+a, gdbSNP:28763997
complement(2625)-t, cdbSNP:376099382
complement(2656)-t, cdbSNP:370351239
complement(2703)-c, adbSNP:200232963
complement(2705)-g, adbSNP:75418446
complement(2720)-t, cdbSNP:112179332
complement(2724)-t, cdbSNP:182421976
complement(2773)-g, adbSNP:17714947
complement(2791)-g, adbSNP:148957597
complement(2800)-c, adbSNP:376261138
complement(2825..2826)-, gdbSNP:35616931
2843+g, tdbSNP:1051956
complement(2860)-g, adbSNP:190192768
2867+g, tdbSNP:1063663
complement(2893)-t, cdbSNP:78192883
complement(2933)-t, cdbSNP:371404960
complement(3041)-t, cdbSNP:377612529
complement(3045)-t, cdbSNP:185682773
complement(3234)-g, adbSNP:181887214
complement(3285)-t, cdbSNP:75512992
3304+a, cdbSNP:1052052
complement(3307..3308)-, tadbSNP:57876792
complement(3319..3320)-, atdbSNP:201314017
complement(3322..3323)-, cdbSNP:35954330
complement(3333..3334)-, aadbSNP:76228399
complement(3342)-c, adbSNP:199973452
complement(3342)-, adbSNP:11329945
complement(3343)-, cdbSNP:200222228
complement(3343)-c, adbSNP:202151040
complement(3343)-ac, cadbSNP:71516436
complement(3347..3348)-c, adbSNP:71534907
complement(3347)-c, adbSNP:200964538
complement(3350..3351)-, c, adbSNP:56898021
complement(3350..3351)-c, adbSNP:71534906
complement(3350)-c, adbSNP:200171770
complement(3354..3355)-, adbSNP:386411659
complement(3356..3357)-, adbSNP:386411658
complement(3360..3361)-, adbSNP:377103051
complement(3382)-t, cdbSNP:7429
Gene SymbolPRKAG2
Gene SynonymAAKG; AAKG2; CMH6; H91620p; WPWS
Chromosome7
Locus Map7q36.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001040633 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant c, mRNA. On-demand $219.00 7-9
NM_024429 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant b, mRNA. In-stock $99.00 5-7
NM_016203 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA. On-demand $219.00 7-9
XM_005250002 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_005250003 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X2, mRNA. On-demand $219.00 7-9
XM_006716021 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X9, mRNA. On-demand $219.00 7-9
XM_005250004 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X3, mRNA. On-demand $219.00 7-9
XM_005250005 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X4, mRNA. On-demand $219.00 7-9
XM_005250006 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X5, mRNA. On-demand $219.00 7-9
XM_005250007 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X6, mRNA. On-demand $219.00 7-9
XM_005250009 PREDICTED: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant X8, mRNA. On-demand $219.00 7-9
Title Identification and functional analysis of a novel PRKAG2 mutation responsible for Chinese PRKAG2 cardiac syndrome reveal an important role of non-CBS domains in regulating the AMPK pathway .
Author Zhang BL, Xu RL, Zhang J, Zhao XX, Wu H, Ma LP, Hu JQ, Zhang JL, Ye Z, Zheng X and Qin YW.
Journal J Cardiol 62 (4), 241-248 (2013)
Title Cardiac hypertrophy, accessory pathway, and conduction system disease in an adolescent: the PRKAG2 cardiac syndrome .
Author Fabris E, Brun F, Porto AG, Losurdo P, Vitali Serdoz L, Zecchin M, Severini GM, Mestroni L, Di Chiara A and Sinagra G.
Journal J. Am. Coll. Cardiol. 62 (9), E17 (2013)
Title Genome-wide association analyses identify 18 new loci associated with serum urate concentrations .
Author Kottgen A, Albrecht E, Teumer A, Vitart V, Krumsiek J, Hundertmark C, Pistis G, Ruggiero D, O'Seaghdha CM, Haller T, Yang Q, Tanaka T, Johnson AD, Kutalik Z, Smith AV, Shi J, Struchalin M, Middelberg RP, Brown MJ, Gaffo AL, Pirastu N, Li G, Hayward C, Zemunik T, Huffman J, Yengo L, Zhao JH, Demirkan A, Feitosa MF, Liu X, Malerba G, Lopez LM, van der Harst P, Li X, Kleber ME, Hicks AA, Nolte IM, Johansson A, Murgia F, Wild SH, Bakker SJ, Peden JF, Dehghan A, Steri M, Tenesa A, Lagou V, Salo P, Mangino M, Rose LM, Lehtimaki T, Woodward OM, Okada Y, Tin A, Muller C, Oldmeadow C, Putku M, Czamara D, Kraft P, Frogheri L, Thun GA, Grotevendt A, Gislason GK, Harris TB, Launer LJ, McArdle P, Shuldiner AR, Boerwinkle E, Coresh J, Schmidt H, Schallert M, Martin NG, Montgomery GW, Kubo M, Nakamura Y, Tanaka T, Munroe PB, Samani NJ, Jacobs DR Jr, Liu K, D'Adamo P, Ulivi S, Rotter JI, Psaty BM, Vollenweider P, Waeber G, Campbell S, Devuyst O, Navarro P, Kolcic I, Hastie N, Balkau B, Froguel P, Esko T, Salumets A, Khaw KT, Langenberg C, Wareham NJ, Isaacs A, Kraja A, Zhang Q, Wild PS, Scott RJ, Holliday EG, Org E, Viigimaa M, Bandinelli S, Metter JE, Lupo A, Trabetti E, Sorice R, Doring A, Lattka E, Strauch K, Theis F, Waldenberger M, Wichmann HE, Davies G, Gow AJ, Bruinenberg M, Stolk RP, Kooner JS, Zhang W, Winkelmann BR, Boehm BO, Lucae S, Penninx BW, Smit JH, Curhan G, Mudgal P, Plenge RM, Portas L, Persico I, Kirin M, Wilson JF, Mateo Leach I, van Gilst WH, Goel A, Ongen H, Hofman A, Rivadeneira F, Uitterlinden AG, Imboden M, von Eckardstein A, Cucca F, Nagaraja R, Piras MG, Nauck M, Schurmann C, Budde K, Ernst F, Farrington SM, Theodoratou E, Prokopenko I, Stumvoll M, Jula A, Perola M, Salomaa V, Shin SY, Spector TD, Sala C, Ridker PM, Kahonen M, Viikari J, Hengstenberg C, Nelson CP, Meschia JF, Nalls MA, Sharma P, Singleton AB, Kamatani N, Zeller T, Burnier M, Attia J, Laan M, Klopp N, Hillege HL, Kloiber S, Choi H, Pirastu M, Tore S, Probst-Hensch NM, Volzke H, Gudnason V, Parsa A, Schmidt R, Whitfield JB, Fornage M, Gasparini P, Siscovick DS, Polasek O, Campbell H, Rudan I, Bouatia-Naji N, Metspalu A, Loos RJ, van Duijn CM, Borecki IB, Ferrucci L, Gambaro G, Deary IJ, Wolffenbuttel BH, Chambers JC, Marz W, Pramstaller PP, Snieder H, Gyllensten U, Wright AF, Navis G, Watkins H, Witteman JC, Sanna S, Schipf S, Dunlop MG, Tonjes A, Ripatti S, Soranzo N, Toniolo D, Chasman DI, Raitakari O, Kao WH, Ciullo M, Fox CS, Caulfield M, Bochud M and Gieger C.
Journal Nat. Genet. 45 (2), 145-154 (2013)
Title AMP-activated protein kinase is required for the macropinocytic internalization of ebolavirus .
Author Kondratowicz AS, Hunt CL, Davey RA, Cherry S and Maury WJ.
Journal J. Virol. 87 (2), 746-755 (2013)
Title Seventy-five genetic loci influencing the human red blood cell .
Author van der Harst P, Zhang W, Mateo Leach I, Rendon A, Verweij N, Sehmi J, Paul DS, Elling U, Allayee H, Li X, Radhakrishnan A, Tan ST, Voss K, Weichenberger CX, Albers CA, Al-Hussani A, Asselbergs FW, Ciullo M, Danjou F, Dina C, Esko T, Evans DM, Franke L, Gogele M, Hartiala J, Hersch M, Holm H, Hottenga JJ, Kanoni S, Kleber ME, Lagou V, Langenberg C, Lopez LM, Lyytikainen LP, Melander O, Murgia F, Nolte IM, O'Reilly PF, Padmanabhan S, Parsa A, Pirastu N, Porcu E, Portas L, Prokopenko I, Ried JS, Shin SY, Tang CS, Teumer A, Traglia M, Ulivi S, Westra HJ, Yang J, Zhao JH, Anni F, Abdellaoui A, Attwood A, Balkau B, Bandinelli S, Bastardot F, Benyamin B, Boehm BO, Cookson WO, Das D, de Bakker PI, de Boer RA, de Geus EJ, de Moor MH, Dimitriou M, Domingues FS, Doring A, Engstrom G, Eyjolfsson GI, Ferrucci L, Fischer K, Galanello R, Garner SF, Genser B, Gibson QD, Girotto G, Gudbjartsson DF, Harris SE, Hartikainen AL, Hastie CE, Hedblad B, Illig T, Jolley J, Kahonen M, Kema IP, Kemp JP, Liang L, Lloyd-Jones H, Loos RJ, Meacham S, Medland SE, Meisinger C, Memari Y, Mihailov E, Miller K, Moffatt MF, Nauck M, Novatchkova M, Nutile T, Olafsson I, Onundarson PT, Parracciani D, Penninx BW, Perseu L, Piga A, Pistis G, Pouta A, Puc U, Raitakari O, Ring SM, Robino A, Ruggiero D, Ruokonen A, Saint-Pierre A, Sala C, Salumets A, Sambrook J, Schepers H, Schmidt CO, Sillje HH, Sladek R, Smit JH, Starr JM, Stephens J, Sulem P, Tanaka T, Thorsteinsdottir U, Tragante V, van Gilst WH, van Pelt LJ, van Veldhuisen DJ, Volker U, Whitfield JB, Willemsen G, Winkelmann BR, Wirnsberger G, Algra A, Cucca F, d'Adamo AP, Danesh J, Deary IJ, Dominiczak AF, Elliott P, Fortina P, Froguel P, Gasparini P, Greinacher A, Hazen SL, Jarvelin MR, Khaw KT, Lehtimaki T, Maerz W, Martin NG, Metspalu A, Mitchell BD, Montgomery GW, Moore C, Navis G, Pirastu M, Pramstaller PP, Ramirez-Solis R, Schadt E, Scott J, Shuldiner AR, Smith GD, Smith JG, Snieder H, Sorice R, Spector TD, Stefansson K, Stumvoll M, Tang WH, Toniolo D, Tonjes A, Visscher PM, Vollenweider P, Wareham NJ, Wolffenbuttel BH, Boomsma DI, Beckmann JS, Dedoussis GV, Deloukas P, Ferreira MA, Sanna S, Uda M, Hicks AA, Penninger JM, Gieger C, Kooner JS, Ouwehand WH, Soranzo N and Chambers JC.
Journal Nature 492 (7429), 369-375 (2012)
Title Mammalian AMP-activated protein kinase subfamily .
Author Stapleton D, Mitchelhill KI, Gao G, Widmer J, Michell BJ, Teh T, House CM, Fernandez CS, Cox T, Witters LA and Kemp BE.
Journal J. Biol. Chem. 271 (2), 611-614 (1996)
Title Familial Hypertrophic cardiomyopathy with Wolff-Parkinson-White syndrome maps to a locus on chromosome 7q3 .
Author MacRae CA, Ghaisas N, Kass S, Donnelly S, Basson CT, Watkins HC, Anan R, Thierfelder LH, McGarry K and Rowland E.
Journal J. Clin. Invest. 96 (3), 1216-1220 (1995)
Title HIV Gag p17 protein impairs proliferation of normal lymphocytes in vitro .
Author Hofmann,B., Nishanian,P., Fan,J., Nguyen,T. and Fahey,J.L.
Journal AIDS 8 (7), 1016-1017 (1994)
Title Human immunodeficiency virus proteins induce the inhibitory cAMP/protein kinase A pathway in normal lymphocytes .
Author Hofmann B, Nishanian P, Nguyen T, Insixiengmay P and Fahey JL.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (14), 6676-6680 (1993)
Title HIV inhibits the early steps of lymphocyte activation, including initiation of inositol phospholipid metabolism .
Author Hofmann B, Nishanian P, Baldwin RL, Insixiengmay P, Nel A and Fahey JL.
Journal J. Immunol. 145 (11), 3699-3705 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.