• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_016203 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_016203.3, 100913190
Length 3423 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA.
Product 5'-AMP-activated protein kinase subunit gamma-2 isoform a
Comment

Summary: AMP-activated protein kinase (AMPK) is a heterotrimeric protein composed of a catalytic alpha subunit, a noncatalytic beta subunit, and a noncatalytic regulatory gamma subunit. Various forms of each of these subunits exist, encoded by different genes. AMPK is an important energy-sensing enzyme that monitors cellular energy status and functions by inactivating key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This gene is a member of the AMPK gamma subunit family and encodes a protein with four cystathionine beta-synthase domains. Mutations in this gene have been associated with ventricular pre-excitation (Wolff-Parkinson-White syndrome), progressive conduction system disease and cardiac hypertrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (a) represents the longest transcript and encodes the longest isoform (a, also referred to as PRKAG2-a).

RefSeq NP_057287.2
CDS 612..2321
Misc Feature(1)405..407
Misc Feature(2)1080..1082
Misc Feature(3)1080..1082
Misc Feature(4)1095..1097
Misc Feature(5)1110..1112
Misc Feature(6)1443..1832
Misc Feature(7)1686..2048
Misc Feature(8)1719..1784
Misc Feature(9)1911..2270
Misc Feature(10)1914..2264
Exon (1)1..725
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (2)726..797
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (3)798..1077
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (4)1078..1295
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (5)1296..1365
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (6)1366..1475
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (7)1476..1557
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (8)1558..1616
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (9)1617..1662
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (10)1663..1717
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (11)1718..1844
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (12)1845..2010
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (13)2011..2048
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (14)2049..2195
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (15)2196..2289
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Exon (16)2290..3408
Gene:PRKAG2
Gene Synonym:AAKG; AAKG2; CMH6; H91620p; WPWS
Translation MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS IVGIISLSDILQALILTPAGAKQKETETE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-dbSNP:
complement(52)-g, adbSNP:117728810
complement(92)-g, adbSNP:73160072
complement(257)-g, cdbSNP:113257361
complement(274)-t, cdbSNP:73728442
complement(290)-g, adbSNP:142348760
complement(325)-g, cdbSNP:75059373
complement(344)-g, cdbSNP:190746984
complement(522)-c, adbSNP:76351165
complement(572)-g, adbSNP:148715621
complement(586)-g, adbSNP:66628686
complement(596)-t, cdbSNP:200468798
complement(627)-t, adbSNP:3207363
complement(651)-g, cdbSNP:150188173
complement(653)-t, adbSNP:141316327
complement(670)-c, adbSNP:116605521
complement(722)-t, adbSNP:144426409
complement(730)-dbSNP:
complement(730)-t, adbSNP:139653890
complement(741)-t, cdbSNP:144857453
complement(745)-t, adbSNP:181839504
complement(776)-g, adbSNP:202056358
complement(809)-dbSNP:
complement(809)-, gdbSNP:36010423
complement(817)-g, adbSNP:182750960
complement(818)-t, cdbSNP:144384573
complement(835)-g, cdbSNP:199963585
complement(851)-t, gdbSNP:142482217
complement(858)-g, adbSNP:148791216
complement(861)-g, adbSNP:61746358
complement(862)-t, cdbSNP:201953758
complement(909)-t, cdbSNP:79474211
complement(936)-c, adbSNP:139579816
complement(953)-t, cdbSNP:147365679
complement(967)-t, cdbSNP:142808871
complement(998)-g, adbSNP:138610896
complement(1042)-g, adbSNP:150140412
complement(1082)-dbSNP:
complement(1082)-g, adbSNP:141804012
complement(1132)-g, adbSNP:148056866
complement(1167)-g, adbSNP:200392688
complement(1168)-t, cdbSNP:145006140
complement(1179)-g, adbSNP:202200501
complement(1181)-g, adbSNP:141191531
complement(1186)-t, cdbSNP:146578426
complement(1192)-g, adbSNP:145669999
complement(1204)-t, cdbSNP:41317142
complement(1212)-c, adbSNP:148952775
complement(1228)-g, adbSNP:182084936
complement(1229)-t, cdbSNP:145827515
complement(1238)-g, adbSNP:201850057
complement(1247)-t, cdbSNP:149820808
complement(1250)-g, adbSNP:140001300
complement(1270)-g, adbSNP:200181419
complement(1295)-g, adbSNP:151108625
complement(1309)-dbSNP:
complement(1309)-g, cdbSNP:201240745
complement(1323)-t, cdbSNP:200736454
complement(1361)-g, adbSNP:201735117
complement(1421)-dbSNP:
complement(1421)-g, adbSNP:61752000
complement(1490)-dbSNP:
complement(1490)-c, adbSNP:193922697
complement(1508)-g, adbSNP:201876556
1516+a, gdbSNP:121908987
complement(1523)-t, cdbSNP:145029525
complement(1601)-dbSNP:
complement(1601)-g, adbSNP:200919184
complement(1709)-dbSNP:
complement(1709)-t, cdbSNP:116541276
1759+dbSNP:
1759+a, gdbSNP:121908988
complement(1772)-g, adbSNP:189673596
complement(1810)-c, adbSNP:28938173
complement(1878)-dbSNP:
complement(1878)-t, gdbSNP:147349145
complement(1907)-t, cdbSNP:114079815
complement(1915)-t, cdbSNP:200589374
complement(1929)-g, adbSNP:201878539
complement(1935)-t, cdbSNP:199863116
complement(2060)-dbSNP:
complement(2060)-g, adbSNP:148632949
2070+c, tdbSNP:267606976
2074+a, tdbSNP:121908989
complement(2086)-t, adbSNP:186114650
complement(2113)-t, cdbSNP:144077131
2127+c, gdbSNP:267606978
complement(2175)-c, adbSNP:199985555
2200+dbSNP:
2200+a, gdbSNP:267606977
2202+c, gdbSNP:121908990
2203+a, gdbSNP:121908991
complement(2204)-t, cdbSNP:148197254
complement(2209)-c, adbSNP:201542789
complement(2212)-c, adbSNP:200300797
complement(2215)-c, adbSNP:79091144
complement(2234)-t, cdbSNP:28763998
2253+c, tdbSNP:267606979
complement(2292)-dbSNP:
complement(2292)-t, cdbSNP:61744760
complement(2315)-t, cdbSNP:138167675
complement(2323)-g, adbSNP:199559205
complement(2324)-t, cdbSNP:113234987
complement(2327)-t, cdbSNP:181109799
complement(2377)-t, cdbSNP:141781827
complement(2433)-t, cdbSNP:8961
complement(2448)-g, cdbSNP:189787963
complement(2456)-g, adbSNP:184932311
complement(2477)-g, adbSNP:28763997
complement(2703)-c, adbSNP:200232963
complement(2705)-g, adbSNP:75418446
complement(2720)-t, cdbSNP:112179332
complement(2724)-t, cdbSNP:182421976
complement(2773)-g, adbSNP:17714947
complement(2791)-g, adbSNP:148957597
complement(2825..2826)-, gdbSNP:35616931
complement(2843)-t, gdbSNP:1051956
complement(2860)-g, adbSNP:190192768
complement(2867)-t, gdbSNP:1063663
complement(2893)-t, cdbSNP:78192883
complement(3045)-t, cdbSNP:185682773
complement(3234)-g, adbSNP:181887214
complement(3285)-t, cdbSNP:75512992
complement(3304)-c, adbSNP:1052052
complement(3307..3308)-, tadbSNP:57876792
complement(3319..3320)-, atdbSNP:201314017
complement(3323..3324)-, cdbSNP:35954330
complement(3341..3342)-, aadbSNP:76228399
complement(3342..3344)-ac, cadbSNP:71516436
complement(3342)-c, adbSNP:199973452
complement(3342)-, adbSNP:11329945
complement(3343)-, cdbSNP:200222228
complement(3343)-c, adbSNP:202151040
complement(3347..3348)-c, adbSNP:71534907
complement(3347)-c, adbSNP:200964538
complement(3349..3350)-, cdbSNP:11427106
complement(3350..3351)-, c, adbSNP:56898021
complement(3350..3351)-c, adbSNP:71534906
complement(3350)-c, adbSNP:200171770
complement(3351)-t, gdbSNP:1052061
complement(3360..3361)-, adbSNP:71858750
complement(3382)-t, cdbSNP:7429
Gene SymbolPRKAG2
Gene SynonymAAKG; AAKG2; CMH6; H91620p; WPWS
Chromosome7
Locus Map7q36.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001040633 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant c, mRNA. On-demand $699.00 18
NM_016203 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant a, mRNA. On-demand $849.00 20
NM_024429 Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit (PRKAG2), transcript variant b, mRNA. In-stock $418.00 $369.00 10
Title AMP-activated protein kinase is required for the macropinocytic internalization of ebolavirus .
Author Kondratowicz,A.S., Hunt,C.L., Davey,R.A., Cherry,S. and Maury,W.J.
Journal J. Virol. 87 (2), 746-755 (2013)
Title AMPK gamma2 subunit gene PRKAG2 polymorphism associated with cognitive impairment as well as diabetes in old age .
Author Kim,E., Lee,S.H., Lee,K.S., Cheong,H.K., Namkoong,K., Hong,C.H. and Oh,B.H.
Journal Psychoneuroendocrinology 37 (3), 358-365 (2012)
Title A case of familial hypertrophic cardiomyopathy emphasizes the importance of parallel screening of multiple disease genes .
Author Scheffold,T., Waldmuller,S. and Borisov,K.
Journal Clin Res Cardiol 100 (7), 627-628 (2011)
Title Genome-wide association analysis of age at onset and psychotic symptoms in bipolar disorder .
Author Belmonte Mahon,P., Pirooznia,M., Goes,F.S., Seifuddin,F., Steele,J., Lee,P.H., Huang,J., Hamshere,M.L., Depaulo,J.R. Jr., Kelsoe,J.R., Rietschel,M., Nothen,M., Cichon,S., Gurling,H., Purcell,S., Smoller,J.W., Craddock,N., Schulze,T.G., McMahon,F.J., Potash,J.B. and Zandi,P.P.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 156B (3), 370-378 (2011)
Title Association study of energy homeostasis genes and antipsychotic-induced weight gain in patients with schizophrenia .
Author Jassim,G., Ferno,J., Theisen,F.M., Haberhausen,M., Christoforou,A., Havik,B., Gebhardt,S., Remschmidt,H., Mehler-Wex,C., Hebebrand,J., Lehellard,S. and Steen,V.M.
Journal Pharmacopsychiatry 44 (1), 15-20 (2011)
Title Mammalian AMP-activated protein kinase subfamily .
Author Stapleton,D., Mitchelhill,K.I., Gao,G., Widmer,J., Michell,B.J., Teh,T., House,C.M., Fernandez,C.S., Cox,T., Witters,L.A. and Kemp,B.E.
Journal J. Biol. Chem. 271 (2), 611-614 (1996)
Title Familial Hypertrophic cardiomyopathy with Wolff-Parkinson-White syndrome maps to a locus on chromosome 7q3 .
Author MacRae,C.A., Ghaisas,N., Kass,S., Donnelly,S., Basson,C.T., Watkins,H.C., Anan,R., Thierfelder,L.H., McGarry,K., Rowland,E. et al.
Journal J. Clin. Invest. 96 (3), 1216-1220 (1995)
Title HIV Gag p17 protein impairs proliferation of normal lymphocytes in vitro .
Author Hofmann,B., Nishanian,P., Fan,J., Nguyen,T. and Fahey,J.L.
Journal AIDS 8 (7), 1016-1017 (1994)
Title Human immunodeficiency virus proteins induce the inhibitory cAMP/protein kinase A pathway in normal lymphocytes .
Author Hofmann,B., Nishanian,P., Nguyen,T., Insixiengmay,P. and Fahey,J.L.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (14), 6676-6680 (1993)
Title HIV inhibits the early steps of lymphocyte activation, including initiation of inositol phospholipid metabolism .
Author Hofmann,B., Nishanian,P., Baldwin,R.L., Insixiengmay,P., Nel,A. and Fahey,J.L.
Journal J. Immunol. 145 (11), 3699-3705 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.