• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RAB23, member RAS oncogene family (RAB23), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_016277 Homo sapiens RAB23, member RAS oncogene family (RAB23), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_016277.3, 34485713
Length 3037 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens RAB23, member RAS oncogene family (RAB23), transcript variant 1, mRNA.
Product ras-related protein Rab-23
Comment

Summary: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript.

RefSeq NP_057361.3
CDS 621..1334
Misc Feature(1)573..575
Misc Feature(2)648..1127
Misc Feature(3)648..1127
Misc Feature(4)648..653
Misc Feature(5)651..1256
Misc Feature(6)666..689
Misc Feature(7)order(675..692,729..734,738..740,981..986,990..992,
Misc Feature(8)order(690..725,735..740)
Misc Feature(9)order(720..722,735..761)
Misc Feature(10)732..758
Misc Feature(11)order(735..737,747..770,789..791,795..797)
Misc Feature(12)741..743
Misc Feature(13)order(744..746,750..758,801..803,807..809,828..833,
Misc Feature(14)order(744..749,753..755,807..812,831..833,837..839,
Misc Feature(15)744..758
Misc Feature(16)795..809
Misc Feature(17)810..821
Misc Feature(18)order(819..821,825..857)
Misc Feature(19)828..845
Misc Feature(20)852..866
Misc Feature(21)879..896
Misc Feature(22)960..974
Misc Feature(23)981..992
Misc Feature(24)1071..1079
Misc Feature(25)1119..1127
Exon (1)1..555
Gene:RAB23
Gene Synonym:HSPC137
Exon (2)556..775
Gene:RAB23
Gene Synonym:HSPC137
Exon (3)776..861
Gene:RAB23
Gene Synonym:HSPC137
Exon (4)862..1018
Gene:RAB23
Gene Synonym:HSPC137
Exon (5)1019..1101
Gene:RAB23
Gene Synonym:HSPC137
Exon (6)1102..1194
Gene:RAB23
Gene Synonym:HSPC137
Exon (7)1195..3012
Gene:RAB23
Gene Synonym:HSPC137
Translation MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRL MLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQ NKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAED PELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(69)-dbSNP:
complement(69)-g, cdbSNP:192791071
complement(464)-g, adbSNP:190222081
complement(572)-dbSNP:
complement(572)-g, cdbSNP:45474592
complement(598)-g, adbSNP:145059995
complement(645)-t, cdbSNP:150655349
complement(657)-t, cdbSNP:187541185
complement(659..661)-, ggtdbSNP:45469399
complement(671)-g, adbSNP:141279756
complement(713)-t, cdbSNP:201735614
complement(739)-g, adbSNP:45442500
complement(743)-g, adbSNP:148570303
complement(757)-g, adbSNP:144837695
complement(796)-dbSNP:
complement(796)-g, cdbSNP:201141007
complement(859)-t, cdbSNP:145669565
complement(867)-dbSNP:
complement(867)-t, cdbSNP:45460606
complement(921)-t, gdbSNP:45479896
complement(931)-c, adbSNP:189316878
complement(955)-c, adbSNP:201306901
complement(966)-t, cdbSNP:138803099
complement(980)-t, cdbSNP:113692611
complement(987)-t, cdbSNP:113915088
complement(1002)-t, cdbSNP:200997551
complement(1054)-dbSNP:
complement(1054)-t, adbSNP:121908171
complement(1068)-t, cdbSNP:142831012
complement(1091)-t, adbSNP:201981516
complement(1149)-dbSNP:
complement(1149)-t, gdbSNP:138217647
complement(1154)-g, adbSNP:201820320
complement(1156)-t, gdbSNP:150440590
complement(1171)-g, adbSNP:140295281
complement(1172)-t, cdbSNP:201731610
complement(1187)-t, gdbSNP:201056648
complement(1214)-dbSNP:
complement(1214)-c, adbSNP:151203723
complement(1236)-t, adbSNP:202181599
complement(1239)-t, cdbSNP:1040461
complement(1333)-t, cdbSNP:181873164
complement(1334)-t, cdbSNP:142290596
complement(1355)-t, cdbSNP:201558464
complement(1404)-t, adbSNP:114371587
complement(1427)-t, gdbSNP:4559091
complement(1478)-c, adbSNP:2840262
complement(1479)-g, adbSNP:189570356
complement(1615)-t, cdbSNP:143892558
complement(1750)-g, cdbSNP:1411578
complement(1815)-t, adbSNP:1052073
complement(1878)-t, cdbSNP:138311113
complement(2036)-t, cdbSNP:147029150
complement(2056)-g, adbSNP:143345846
complement(2145)-t, cdbSNP:16888378
complement(2318)-t, cdbSNP:148372304
complement(2322)-t, gdbSNP:77353467
complement(2491)-g, adbSNP:186740414
complement(2521..2522)-, tgatdbSNP:139778770
complement(2535)-t, cdbSNP:182142512
complement(2585)-t, cdbSNP:182662
complement(2646)-g, adbSNP:11398
complement(2712)-g, adbSNP:143362760
complement(2755)-g, cdbSNP:189407933
complement(2797)-t, cdbSNP:200498640
complement(2806)-g, adbSNP:149190571
Gene SymbolRAB23
Gene SynonymHSPC137
Chromosome6
Locus Map6p11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_016277 Homo sapiens RAB23, member RAS oncogene family (RAB23), transcript variant 1, mRNA. In-stock $308.00 $259.00 10
NM_183227 Homo sapiens RAB23, member RAS oncogene family (RAB23), transcript variant 2, mRNA. In-stock $308.00 $259.00 10
Title The small GTPases Rab9A and Rab23 function at distinct steps in autophagy during Group A Streptococcus infection .
Author Nozawa,T., Aikawa,C., Goda,A., Maruyama,F., Hamada,S. and Nakagawa,I.
Journal Cell. Microbiol. 14 (8), 1149-1165 (2012)
Title Rab23 negatively regulates Gli1 transcriptional factor in a Su(Fu)-dependent manner .
Author Chi,S., Xie,G., Liu,H., Chen,K., Zhang,X., Li,C. and Xie,J.
Journal Cell. Signal. 24 (6), 1222-1228 (2012)
Title A genome-wide association study reveals evidence of association with sarcoidosis at 6p12.1 .
Author Hofmann,S., Fischer,A., Till,A., Muller-Quernheim,J., Hasler,R., Franke,A., Gade,K.I., Schaarschmidt,H., Rosenstiel,P., Nebel,A., Schurmann,M., Nothnagel,M. and Schreiber,S.
Journal Eur. Respir. J. 38 (5), 1127-1135 (2011)
Title Carpenter syndrome: extended RAB23 mutation spectrum and analysis of nonsense-mediated mRNA decay .
Author Jenkins,D., Baynam,G., De Catte,L., Elcioglu,N., Gabbett,M.T., Hudgins,L., Hurst,J.A., Jehee,F.S., Oley,C. and Wilkie,A.O.
Journal Hum. Mutat. 32 (4), E2069-E2078 (2011)
Title RAB23 mutation in a large family from Comoros Islands with Carpenter syndrome .
Author Alessandri,J.L., Dagoneau,N., Laville,J.M., Baruteau,J., Hebert,J.C. and Cormier-Daire,V.
Journal Am. J. Med. Genet. A 152A (4), 982-986 (2010)
Title Rab23 is a potential biological target for treating hepatocellular carcinoma .
Author Liu,Y.J., Wang,Q., Li,W., Huang,X.H., Zhen,M.C., Huang,S.H., Chen,L.Z., Xue,L. and Zhang,H.W.
Journal World J. Gastroenterol. 13 (7), 1010-1017 (2007)
Title Rab23, a negative regulator of hedgehog signaling, localizes to the plasma membrane and the endocytic pathway .
Author Evans,T.M., Ferguson,C., Wainwright,B.J., Parton,R.G. and Wicking,C.
Journal Traffic 4 (12), 869-884 (2003)
Title Molecular cloning and characterization of human RAB23, a member of the group of Rab GTPases .
Author Marcos,I., Borrego,S. and Antinolo,G.
Journal Int. J. Mol. Med. 12 (6), 983-987 (2003)
Title The DNA sequence and analysis of human chromosome 6 .
Author Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L., Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E., Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R., Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I., Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J., Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O., Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J., Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C., Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M., Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K., Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J., Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L., Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P., Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J., Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M., Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A., Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L., Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R., Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M., King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A., Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J., Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L., McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J., Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K., Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I., Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y., Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K., Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L., Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J., Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A., Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S., Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E., Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M., Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E., Dunham,I., Rogers,J. and Beck,S.
Journal Nature 425 (6960), 805-811 (2003)
Title Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis .
Author Imabayashi,H., Mori,T., Gojo,S., Kiyono,T., Sugiyama,T., Irie,R., Isogai,T., Hata,J., Toyama,Y. and Umezawa,A.
Journal Exp. Cell Res. 288 (1), 35-50 (2003)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.