• THAT   AND
  • THAT   AND


Homo sapiens paired related homeobox 2 (PRRX2), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_016307 Homo sapiens paired related homeobox 2 (PRRX2), mRNA. Full Lenth $384.83
ORF Sequence $220.98


RefSeq Version NM_016307.3, 38505203
Length 1327 bp
Structure linear
Update Date 10-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens paired related homeobox 2 (PRRX2), mRNA.
Product paired mesoderm homeobox protein 2
Comment

Summary: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq]. COMPLETENESS: complete on the 3' end.

RefSeq NP_057391.1
CDS 228..989
Exon (1)1..486
Exon (2)1..486
Exon (3)487..674
Exon (4)675..853
Exon (5)854..1311
Translation MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPG ARAEAREGAAREPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALE RVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQ EAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAK EFSLHHSQVPTVN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
77+a, cdbSNP:115147301
524+a, gdbSNP:35865713
1001+a, cdbSNP:28428946
1035+a, gdbSNP:116237845
complement(1123)-g, cdbSNP:2241898
1140+c, tdbSNP:1051445
1151+c, gdbSNP:28441121
1256+g, tdbSNP:73627671
1300..1301+, a, tdbSNP:36093277
1307+c, tdbSNP:10988483
Gene SymbolPRRX2
Gene SynonymMGC19843; PMX2; PRX2
Chromosome9
Locus Map9q34.1
All Transcripts NM_016307
Title Web-based, participant-driven studies yield novel genetic associations for common traits .
Author Eriksson,N., Macpherson,J.M., Tung,J.Y., Hon,L.S., Naughton,B., Saxonov,S., Avey,L., Wojcicki,A., Pe'er,I. and Mountain,J.
Journal PLoS Genet. 6 (6), E1000993 (2010)
Title Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia .
Author Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J., Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S., Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C.
Journal PLoS ONE 5 (7), E11493 (2010)
Title Oxidation of Prx2 and phosphorylation of GRP58 by angiotensin II in human coronary smooth muscle cells identified by 2D-DIGE analysis .
Author Tokutomi,Y., Araki,N., Kataoka,K., Yamamoto,E. and Kim-Mitsuyama,S.
Journal Biochem. Biophys. Res. Commun. 364 (4), 822-830 (2007)
Title The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors .
Author Wissmuller,S., Kosian,T., Wolf,M., Finzsch,M. and Wegner,M.
Journal Nucleic Acids Res. 34 (6), 1735-1744 (2006)
Title A new translocation t(9;11)(q34;p15) fuses NUP98 to a novel homeobox partner gene, PRRX2, in a therapy-related acute myeloid leukemia .
Author Gervais,C., Mauvieux,L., Perrusson,N., Helias,C., Struski,S., Leymarie,V., Lioure,B. and Lessard,M.
Journal Leukemia 19 (1), 145-148 (2005)
Title GeneChip microarrays facilitate identification of Protease Nexin-1 as a target gene of the Prx2 (S8) homeoprotein .
Author Scott,K.K., Norris,R.A., Potter,S.S., Norrington,D.W., Baybo,M.A., Hicklin,D.M. and Kern,M.J.
Journal DNA Cell Biol. 22 (2), 95-105 (2003)
Title Regulation of vascular smooth muscle cell growth and adhesion by paired-related homeobox genes .
Author Jones,F.S., McKean,D.M., Meech,R., Edelman,D.B., Oakey,R.J. and Jones,P.L.
Journal Chest 121 (3 SUPPL), 89S-90S (2002)
Title Human PRRX1 and PRRX2 genes: cloning, expression, genomic localization, and exclusion as disease genes for Nager syndrome .
Author Norris,R.A., Scott,K.K., Moore,C.S., Stetten,G., Brown,C.R., Jabs,E.W., Wulfsberg,E.A., Yu,J. and Kern,M.J.
Journal Mamm. Genome 11 (11), 1000-1005 (2000)
Title Modulation of the human homeobox genes PRX-2 and HOXB13 in scarless fetal wounds .
Author Stelnicki,E.J., Arbeit,J., Cass,D.L., Saner,C., Harrison,M. and Largman,C.
Journal J. Invest. Dermatol. 111 (1), 57-63 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878