• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens paired related homeobox 2 (PRRX2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
Homo sapiens paired related homeobox 2 (PRRX2), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
C Homo sapiens paired related homeobox 2 (PRRX2), mRNA. Customized vector On-demand $209.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_016307.3, 38505203
Length 762 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens paired related homeobox 2 (PRRX2), mRNA.
Product paired mesoderm homeobox protein 2
Comment

Summary: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC014645.1, AF061970.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_057391.1
CDS 228..989
Misc Feature(1)552..716
Misc Feature(2)552..716
Misc Feature(3)order(552..554,558..560,609..611,627..629,666..668,
Misc Feature(4)order(555..557,675..677,684..689,696..698)
Misc Feature(5)900..962
Misc Feature(6)915..956
Exon (1)1..486
Gene:PRRX2
Gene Synonym:PMX2; PRX2
Exon (2)487..674
Gene:PRRX2
Gene Synonym:PMX2; PRX2
Exon (3)675..853
Gene:PRRX2
Gene Synonym:PMX2; PRX2
Exon (4)854..1311
Gene:PRRX2
Gene Synonym:PMX2; PRX2
Translation MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPG ARAEAREGAAREPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALE RVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQ EAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAK EFSLHHSQVPTVN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
25+dbSNP:
25+c, gdbSNP:368393993
77+a, cdbSNP:115147301
521+dbSNP:
521+c, tdbSNP:370204978
524+a, gdbSNP:35865713
530+a, gdbSNP:201665194
534+a, cdbSNP:201179051
539+c, gdbSNP:149764500
548+c, tdbSNP:376858807
568+a, gdbSNP:370267786
589+c, gdbSNP:373913153
632+a, gdbSNP:199887986
653+c, tdbSNP:376061825
660+c, gdbSNP:202114136
741+dbSNP:
741+c, gdbSNP:145779250
742+c, gdbSNP:140591214
745+c, tdbSNP:144448846
746+a, gdbSNP:146603979
793+c, tdbSNP:141327412
810+c, gdbSNP:143393943
814+a, gdbSNP:201217720
823+a, cdbSNP:148368723
827+a, cdbSNP:372702758
829+c, gdbSNP:140111310
883+dbSNP:
883+c, tdbSNP:150293718
923+c, tdbSNP:138042846
933+c, tdbSNP:202233874
934+a, gdbSNP:201083423
944+c, tdbSNP:200632042
979+c, tdbSNP:143523637
980+a, gdbSNP:373951160
1001+a, cdbSNP:28428946
1014+c, tdbSNP:370487741
1035+a, gdbSNP:116237845
1065+a, gdbSNP:373341887
1090+a, gdbSNP:142417382
1123+c, gdbSNP:2241898
1140+c, tdbSNP:1051445
1147+a, gdbSNP:370014709
1151+c, gdbSNP:28441121
1256+g, tdbSNP:73627671
1294..1295+, tdbSNP:373156929
1300..1301+, a, tdbSNP:36093277
1307+c, tdbSNP:10988483
Gene SymbolPRRX2
Gene SynonymPMX2; PRX2
Chromosome9
Locus Map9q34.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_016307 Homo sapiens paired related homeobox 2 (PRRX2), mRNA. On-demand TBD TBD
XM_006717142 PREDICTED: Homo sapiens paired related homeobox 2 (PRRX2), transcript variant X1, partial mRNA. On-demand TBD TBD
Title Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study .
Author Nagy P, Karton A, Betz A, Peskin AV, Pace P, O'Reilly RJ, Hampton MB, Radom L and Winterbourn CC.
Journal J. Biol. Chem. 286 (20), 18048-18055 (2011)
Title Web-based, participant-driven studies yield novel genetic associations for common traits .
Author Eriksson N, Macpherson JM, Tung JY, Hon LS, Naughton B, Saxonov S, Avey L, Wojcicki A, Pe'er I and Mountain J.
Journal PLoS Genet. 6 (6), E1000993 (2010)
Title Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia .
Author Jugessur A, Shi M, Gjessing HK, Lie RT, Wilcox AJ, Weinberg CR, Christensen K, Boyles AL, Daack-Hirsch S, Nguyen TT, Christiansen L, Lidral AC and Murray JC.
Journal PLoS ONE 5 (7), E11493 (2010)
Title Oxidation of Prx2 and phosphorylation of GRP58 by angiotensin II in human coronary smooth muscle cells identified by 2D-DIGE analysis .
Author Tokutomi Y, Araki N, Kataoka K, Yamamoto E and Kim-Mitsuyama S.
Journal Biochem. Biophys. Res. Commun. 364 (4), 822-830 (2007)
Title The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors .
Author Wissmuller S, Kosian T, Wolf M, Finzsch M and Wegner M.
Journal Nucleic Acids Res. 34 (6), 1735-1744 (2006)
Title A new translocation t(9;11)(q34;p15) fuses NUP98 to a novel homeobox partner gene, PRRX2, in a therapy-related acute myeloid leukemia .
Author Gervais,C., Mauvieux,L., Perrusson,N., Helias,C., Struski,S., Leymarie,V., Lioure,B. and Lessard,M.
Journal Leukemia 19 (1), 145-148 (2005)
Title GeneChip microarrays facilitate identification of Protease Nexin-1 as a target gene of the Prx2 (S8) homeoprotein .
Author Scott KK, Norris RA, Potter SS, Norrington DW, Baybo MA, Hicklin DM and Kern MJ.
Journal DNA Cell Biol. 22 (2), 95-105 (2003)
Title Regulation of vascular smooth muscle cell growth and adhesion by paired-related homeobox genes .
Author Jones FS, McKean DM, Meech R, Edelman DB, Oakey RJ and Jones PL.
Journal Chest 121 (3 SUPPL), 89S-90S (2002)
Title Human PRRX1 and PRRX2 genes: cloning, expression, genomic localization, and exclusion as disease genes for Nager syndrome .
Author Norris RA, Scott KK, Moore CS, Stetten G, Brown CR, Jabs EW, Wulfsberg EA, Yu J and Kern MJ.
Journal Mamm. Genome 11 (11), 1000-1005 (2000)
Title Modulation of the human homeobox genes PRX-2 and HOXB13 in scarless fetal wounds .
Author Stelnicki EJ, Arbeit J, Cass DL, Saner C, Harrison M and Largman C.
Journal J. Invest. Dermatol. 111 (1), 57-63 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.