• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_016363 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA. ORF Sequence $295.80
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_016363.4, 143770754
Length 2264 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA.
Product platelet glycoprotein VI isoform 2 precursor
Comment

Summary: This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011].


Transcript Variant: This variant (2) uses an alternate splice site in the 3' coding region, compared to variant 1, that results in a frameshift. It encodes isoform 2 which has a shorter and distinct C-terminus compared to isoform 1.

RefSeq NP_057447.4
CDS 29..1048
Misc Feature(1)20..22
Misc Feature(2)104..352
Misc Feature(3)order(206..208,293..295,314..316)
Misc Feature(4)365..634
Misc Feature(5)830..892
Exon (1)1..62
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (2)63..95
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (3)96..353
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (4)354..638
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (5)639..692
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (6)693..752
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (7)753..803
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (8)804..2264
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Translation MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC YSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFT TETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRH RGRAVQRPLPPLPPLPQTRKSHGGQDGGRQDVHSRGLCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-g, adbSNP:187629313
complement(43)-g, adbSNP:28385642
complement(46)-g, adbSNP:199807828
complement(88)-dbSNP:
complement(88)-c, adbSNP:201025246
complement(110)-dbSNP:
complement(110)-g, adbSNP:201283598
complement(125)-t, cdbSNP:28385643
complement(132)-g, cdbSNP:200313847
complement(165)-g, adbSNP:113219102
complement(200)-g, adbSNP:199588110
complement(211)-t, cdbSNP:200403102
complement(226)-t, cdbSNP:146751606
complement(247)-t, cdbSNP:28385644
complement(253)-g, adbSNP:189503167
complement(265)-g, adbSNP:28385645
complement(270)-t, cdbSNP:200424845
complement(335)-t, g, cdbSNP:28969501
complement(354)-dbSNP:
complement(354)-t, cdbSNP:41311975
complement(391)-g, cdbSNP:79133006
complement(418)-t, adbSNP:115934645
complement(475)-t, cdbSNP:201166741
complement(512)-t, gdbSNP:892090
complement(523)-g, adbSNP:892089
complement(535)-g, adbSNP:5030705
complement(595)-t, gdbSNP:201652983
complement(596)-g, cdbSNP:41300084
complement(601)-g, cdbSNP:41301959
complement(604)-t, cdbSNP:1654425
complement(612)-t, cdbSNP:200525940
complement(683)-dbSNP:
complement(683)-g, adbSNP:1613662
complement(715)-dbSNP:
complement(715)-t, cdbSNP:199576708
complement(737)-t, cdbSNP:1654416
complement(747)-g, cdbSNP:201917182
complement(773)-dbSNP:
complement(773)-t, cdbSNP:2304167
complement(776)-t, gdbSNP:202044825
complement(853)-dbSNP:
complement(853)-g, adbSNP:190904614
complement(856)-t, cdbSNP:60843302
complement(871)-t, adbSNP:201436629
complement(908)-g, adbSNP:201753264
complement(909)-t, cdbSNP:201997410
complement(957)-g, adbSNP:200151153
complement(964)-g, cdbSNP:2304166
complement(966)-g, adbSNP:200431311
complement(978)-t, adbSNP:1654413
complement(992)-t, gdbSNP:1671152
complement(995)-t, cdbSNP:80348265
complement(997)-g, cdbSNP:200948100
complement(1031)-g, adbSNP:201413568
complement(1047)-t, cdbSNP:201603906
complement(1067)-t, cdbSNP:186103270
complement(1070)-g, adbSNP:200019444
complement(1166)-t, cdbSNP:182940784
complement(1184)-g, adbSNP:199813278
complement(1215..1216)-, gacadbSNP:59110861
complement(1215)-g, cdbSNP:200940260
complement(1216)-, gacadbSNP:80098651
complement(1230..1233)-, cagadbSNP:113550298
complement(1231..1232)-, agacdbSNP:71916377
complement(1233..1234)-, cagadbSNP:138680589
complement(1268)-g, cdbSNP:150807394
complement(1311)-t, cdbSNP:74697203
complement(1373)-g, adbSNP:201940503
complement(1443)-g, adbSNP:1671151
complement(1483)-g, adbSNP:141737256
complement(1491)-g, adbSNP:199561271
complement(1519)-t, cdbSNP:41275822
complement(1539)-t, cdbSNP:146318651
complement(1549)-t, cdbSNP:142053457
complement(1555)-g, cdbSNP:200399196
complement(1574)-c, adbSNP:200566792
complement(1681)-t, cdbSNP:201681535
complement(1741)-t, cdbSNP:1654412
complement(1751)-t, cdbSNP:10418074
complement(1789)-t, cdbSNP:190384471
complement(1813)-t, gdbSNP:115459014
complement(1829)-t, cdbSNP:2886416
complement(1840)-g, adbSNP:1671150
complement(1898)-c, adbSNP:138796044
complement(1911)-t, gdbSNP:76129219
complement(1936)-t, adbSNP:186874802
complement(1949)-t, gdbSNP:10417981
complement(2000)-g, adbSNP:10417943
complement(2129)-t, gdbSNP:143249922
complement(2135)-g, adbSNP:149570465
complement(2222)-g, adbSNP:41275820
Gene SymbolGP6
Gene SynonymBDPLT11; GPIV; GPVI
Chromosome19
Locus Map19q13.4
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001083899 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 1, mRNA. Full Length $657.72
ORF Sequence $540.27
NM_001256017 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 3, mRNA. Full Length $640.90
ORF Sequence $280.14
NM_016363 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA. Full Length $656.56
ORF Sequence $295.80
Title Novel alpha2beta1 integrin inhibitors reveal that integrin binding to collagen under shear stress conditions does not require receptor preactivation .
Author Nissinen,L., Koivunen,J., Kapyla,J., Salmela,M., Nieminen,J., Jokinen,J., Sipila,K., Pihlavisto,M., Pentikainen,O.T., Marjamaki,A. and Heino,J.
Journal J. Biol. Chem. 287 (53), 44694-44702 (2012)
Title The prevalence of the platelet glycoprotein VI polymorphisms in patients with sticky platelet syndrome and ischemic stroke .
Author Kubisz,P., Ivankova,J., Skerenova,M., Stasko,J. and Holly,P.
Journal Hematology 17 (6), 355-362 (2012)
Title Platelet aggregation abnormalities in patients with fetal losses: the GP6 gene polymorphism .
Author Sokol,J., Biringer,K., Skerenova,M., Hasko,M., Bartosova,L., Stasko,J., Danko,J. and Kubisz,P.
Journal Fertil. Steril. 98 (5), 1170-1174 (2012)
Title Diagnostic and therapeutic potentials of platelet glycoprotein VI .
Author Bigalke,B., Kramer,B.F., Seizer,P., Fateh-Moghadam,S., Gawaz,M. and Lindemann,S.
Journal Semin. Thromb. Hemost. 36 (2), 203-211 (2010)
Title Absence of collagen-induced platelet activation caused by compound heterozygous GPVI mutations .
Author Dumont,B., Lasne,D., Rothschild,C., Bouabdelli,M., Ollivier,V., Oudin,C., Ajzenberg,N., Grandchamp,B. and Jandrot-Perrus,M.
Journal Blood 114 (9), 1900-1903 (2009)
Title Molecular cloning, genomic structure, chromosomal localization, and alternative splice forms of the platelet collagen receptor glycoprotein VI .
Author Ezumi,Y., Uchiyama,T. and Takayama,H.
Journal Biochem. Biophys. Res. Commun. 277 (1), 27-36 (2000)
Title Cloning, characterization, and functional studies of human and mouse glycoprotein VI: a platelet-specific collagen receptor from the immunoglobulin superfamily .
Author Jandrot-Perrus,M., Busfield,S., Lagrue,A.H., Xiong,X., Debili,N., Chickering,T., Le Couedic,J.P., Goodearl,A., Dussault,B., Fraser,C., Vainchenker,W. and Villeval,J.L.
Journal Blood 96 (5), 1798-1807 (2000)
Title Syk, activated by cross-linking the B-cell antigen receptor, localizes to the cytosol where it interacts with and phosphorylates alpha-tubulin on tyrosine .
Author Peters,J.D., Furlong,M.T., Asai,D.J., Harrison,M.L. and Geahlen,R.L.
Journal J. Biol. Chem. 271 (9), 4755-4762 (1996)
Title Membrane glycoprotein IV (CD36) is physically associated with the Fyn, Lyn, and Yes protein-tyrosine kinases in human platelets .
Author Huang,M.M., Bolen,J.B., Barnwell,J.W., Shattil,S.J. and Brugge,J.S.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (17), 7844-7848 (1991)
Title A patient with platelets deficient in glycoprotein VI that lack both collagen-induced aggregation and adhesion .
Author Moroi,M., Jung,S.M., Okuma,M. and Shinmyozu,K.
Journal J. Clin. Invest. 84 (5), 1440-1445 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878