• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21878 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu21878C Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_016363.5, 563580295
Length 1020 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA.
Product platelet glycoprotein VI isoform 2 precursor
Comment

Summary: This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011].


Transcript Variant: This variant (2) uses an alternate splice site in the 3' coding region, compared to variant 1, that results in a frameshift. It encodes isoform 2 which has a shorter and distinct C-terminus compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_057447.5
CDS 29..1048
Misc Feature(1)20..22
Misc Feature(2)104..352
Misc Feature(3)order(206..208,293..295,314..316)
Misc Feature(4)365..634
Misc Feature(5)830..892
Exon (1)1..62
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (2)63..95
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (3)96..353
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (4)354..638
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (5)639..692
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (6)693..752
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (7)753..803
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Exon (8)804..2264
Gene:GP6
Gene Synonym:BDPLT11; GPIV; GPVI
Translation MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC YSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFT TETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRH RGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-g, adbSNP:187629313
complement(18)-t, cdbSNP:376612602
complement(42)-g, adbSNP:371674665
43+a, gdbSNP:28385642
complement(46)-g, adbSNP:199807828
complement(87)-dbSNP:
complement(87)-g, adbSNP:369642453
complement(88)-t, c, adbSNP:201025246
complement(100)-dbSNP:
complement(100)-t, cdbSNP:368522136
complement(110)-g, adbSNP:201283598
complement(125)-t, cdbSNP:28385643
complement(132)-g, cdbSNP:200313847
complement(165)-g, adbSNP:113219102
complement(200)-g, adbSNP:199588110
complement(211)-t, cdbSNP:200403102
complement(226)-t, cdbSNP:146751606
247+c, tdbSNP:28385644
complement(253)-g, adbSNP:189503167
265+a, gdbSNP:28385645
complement(270)-t, cdbSNP:200424845
complement(319)-g, adbSNP:370941526
335+c, g, tdbSNP:28969501
complement(343)-g, adbSNP:374599974
complement(354)-dbSNP:
complement(354)-t, cdbSNP:41311975
complement(388)-g, adbSNP:375405887
complement(389)-t, cdbSNP:372032713
complement(391)-g, cdbSNP:79133006
complement(414)-t, adbSNP:375205262
complement(418)-t, adbSNP:115934645
complement(447)-g, adbSNP:374450055
complement(453)-t, adbSNP:371526523
complement(475)-t, cdbSNP:201166741
complement(512)-t, gdbSNP:892090
complement(523)-g, adbSNP:892089
535+a, gdbSNP:5030705
552+a, gdbSNP:387906919
complement(553)-g, adbSNP:367907292
complement(581)-t, cdbSNP:369568059
complement(595)-t, gdbSNP:201652983
complement(596)-g, cdbSNP:41300084
complement(601)-g, cdbSNP:41301959
complement(604)-t, cdbSNP:1654425
complement(606)-g, adbSNP:370855777
complement(612)-t, cdbSNP:200525940
complement(659)-dbSNP:
complement(659)-g, cdbSNP:368555743
complement(660)-t, cdbSNP:373154193
complement(683)-g, adbSNP:1613662
complement(715)-dbSNP:
complement(715)-t, cdbSNP:199576708
complement(737)-t, cdbSNP:1654416
complement(747)-g, cdbSNP:201917182
complement(773)-dbSNP:
complement(773)-t, cdbSNP:2304167
complement(776)-t, gdbSNP:202044825
complement(799)-t, cdbSNP:373073778
complement(843)-dbSNP:
complement(843)-t, cdbSNP:372829679
complement(853)-g, adbSNP:190904614
complement(856)-t, cdbSNP:60843302
complement(871)-t, adbSNP:201436629
complement(908)-g, adbSNP:201753264
complement(909)-t, cdbSNP:201997410
complement(923)-g, adbSNP:371817808
complement(952)-t, cdbSNP:373346261
complement(957)-g, adbSNP:200151153
complement(964)-g, cdbSNP:2304166
complement(966)-g, adbSNP:200431311
complement(978)-t, adbSNP:1654413
complement(992)-t, gdbSNP:1671152
complement(995)-t, cdbSNP:80348265
complement(997)-g, cdbSNP:200948100
complement(1013)-g, adbSNP:368858591
complement(1014)-t, cdbSNP:374509474
complement(1019)-t, cdbSNP:267605686
complement(1031)-g, adbSNP:201413568
complement(1047)-t, cdbSNP:201603906
complement(1067)-t, cdbSNP:186103270
complement(1070)-g, adbSNP:200019444
complement(1080)-c, adbSNP:375643910
complement(1117)-g, adbSNP:373596955
complement(1118)-g, cdbSNP:370477228
complement(1129)-t, cdbSNP:377522937
complement(1166)-t, cdbSNP:182940784
complement(1184)-g, adbSNP:199813278
complement(1215..1216)-, gacadbSNP:59110861
complement(1215)-g, cdbSNP:200940260
complement(1232..1233)-, cagadbSNP:375520233
complement(1233..1234)-, cagadbSNP:138680589
complement(1264)-t, cdbSNP:370026589
complement(1268)-g, cdbSNP:150807394
complement(1311)-t, cdbSNP:74697203
complement(1373)-g, adbSNP:201940503
complement(1416)-g, adbSNP:369436148
complement(1443)-g, adbSNP:1671151
complement(1452)-g, adbSNP:377575412
complement(1483)-g, adbSNP:141737256
complement(1491)-g, adbSNP:199561271
complement(1513)-g, adbSNP:368961812
complement(1519)-t, cdbSNP:41275822
complement(1539)-t, cdbSNP:146318651
complement(1549)-t, cdbSNP:142053457
complement(1555)-g, cdbSNP:200399196
complement(1569)-t, cdbSNP:374982514
complement(1574)-c, adbSNP:200566792
complement(1579)-g, adbSNP:375130495
complement(1580)-c, adbSNP:372569183
complement(1589)-g, adbSNP:368350811
complement(1610)-c, adbSNP:374590810
complement(1623)-g, cdbSNP:372175929
complement(1647)-t, cdbSNP:368531531
complement(1681)-t, cdbSNP:201681535
complement(1741)-t, cdbSNP:1654412
complement(1751)-t, cdbSNP:10418074
complement(1769)-c, adbSNP:372168591
complement(1789)-t, cdbSNP:190384471
complement(1813)-t, gdbSNP:115459014
1829+c, tdbSNP:2886416
complement(1840)-g, adbSNP:1671150
complement(1898)-c, adbSNP:138796044
complement(1911)-t, gdbSNP:76129219
complement(1936)-t, adbSNP:186874802
complement(1949)-t, gdbSNP:10417981
complement(2000)-g, adbSNP:10417943
complement(2000)-g, adbSNP:386507063
2129+g, tdbSNP:143249922
complement(2135)-g, adbSNP:149570465
complement(2222)-g, adbSNP:41275820
Gene SymbolGP6
Gene SynonymBDPLT11; GPIV; GPVI
Chromosome19
Locus Map19q13.4
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_016363 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_016363 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_016363 Homo sapiens glycoprotein VI (platelet) (GP6), transcript variant 2, mRNA. On-demand $219.00 7-9
Title RhoG protein regulates glycoprotein VI-Fc receptor gamma-chain complex-mediated platelet activation and thrombus formation .
Author Kim S, Dangelmaier C, Bhavanasi D, Meng S, Wang H, Goldfinger LE and Kunapuli SP.
Journal J. Biol. Chem. 288 (47), 34230-34238 (2013)
Title An adenine insertion in exon 6 of human GP6 generates a truncated protein associated with a bleeding disorder in four Chilean families .
Author Matus V, Valenzuela G, Saez CG, Hidalgo P, Lagos M, Aranda E, Panes O, Pereira J, Pillois X, Nurden AT and Mezzano D.
Journal J. Thromb. Haemost. 11 (9), 1751-1759 (2013)
Title 12-lipoxygenase activity plays an important role in PAR4 and GPVI-mediated platelet reactivity .
Author Yeung J, Apopa PL, Vesci J, Stolla M, Rai G, Simeonov A, Jadhav A, Fernandez-Perez P, Maloney DJ, Boutaud O, Holman TR and Holinstat M.
Journal Thromb. Haemost. 110 (3), 569-581 (2013)
Title Diagnostic and therapeutic potentials of platelet glycoprotein VI .
Author Bigalke B, Kramer BF, Seizer P, Fateh-Moghadam S, Gawaz M and Lindemann S.
Journal Semin. Thromb. Hemost. 36 (2), 203-211 (2010)
Title Absence of collagen-induced platelet activation caused by compound heterozygous GPVI mutations .
Author Dumont B, Lasne D, Rothschild C, Bouabdelli M, Ollivier V, Oudin C, Ajzenberg N, Grandchamp B and Jandrot-Perrus M.
Journal Blood 114 (9), 1900-1903 (2009)
Title Molecular cloning, genomic structure, chromosomal localization, and alternative splice forms of the platelet collagen receptor glycoprotein VI .
Author Ezumi Y, Uchiyama T and Takayama H.
Journal Biochem. Biophys. Res. Commun. 277 (1), 27-36 (2000)
Title Cloning, characterization, and functional studies of human and mouse glycoprotein VI: a platelet-specific collagen receptor from the immunoglobulin superfamily .
Author Jandrot-Perrus M, Busfield S, Lagrue AH, Xiong X, Debili N, Chickering T, Le Couedic JP, Goodearl A, Dussault B, Fraser C, Vainchenker W and Villeval JL.
Journal Blood 96 (5), 1798-1807 (2000)
Title Syk, activated by cross-linking the B-cell antigen receptor, localizes to the cytosol where it interacts with and phosphorylates alpha-tubulin on tyrosine .
Author Peters JD, Furlong MT, Asai DJ, Harrison ML and Geahlen RL.
Journal J. Biol. Chem. 271 (9), 4755-4762 (1996)
Title Membrane glycoprotein IV (CD36) is physically associated with the Fyn, Lyn, and Yes protein-tyrosine kinases in human platelets .
Author Huang MM, Bolen JB, Barnwell JW, Shattil SJ and Brugge JS.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (17), 7844-7848 (1991)
Title A patient with platelets deficient in glycoprotein VI that lack both collagen-induced aggregation and adhesion .
Author Moroi M, Jung SM, Okuma M and Shinmyozu K.
Journal J. Clin. Invest. 84 (5), 1440-1445 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.