• THAT   AND
  • THAT   AND


Homo sapiens apelin (APLN), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_017413 Homo sapiens apelin (APLN), mRNA. Full Lenth $1133.30
ORF Sequence $159.00
RefSeq Version NM_017413.4, 290645488
Length 3238 bp
Structure linear
Update Date 27-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens apelin (APLN), mRNA.
Product apelin preproprotein
Comment

Summary: This gene encodes a peptide that functions as an endogenous ligand for the G protein coupled receptor APJ. The encoded protein is synthesized as a prepropeptide that is processed into biologically active C-terminal fragments. The peptide fragments activate different tissue specific signaling pathways that regulate diverse biological functions including fluid homeostasis, cardiovascular function and insulin secretion. This protein also functions as a coreceptor for the human immunodeficiency virus 1.

RefSeq NP_059109.3
CDS 327..560
Exon (1)1..393
Exon (2)1..393
Exon (3)394..565
Exon (4)566..3224
Translation MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR KFRRQRPRLSHKGPMPF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(220)-g, adbSNP:2281069
complement(387)-t, adbSNP:113697270
596+g, tdbSNP:3115758
complement(718..719)-, gdbSNP:34209835
complement(766)-t, adbSNP:113725363
944+a, gdbSNP:3115759
complement(2068)-g, cdbSNP:5975126
complement(2076)-c, adbSNP:6637638
complement(2118)-g, cdbSNP:61363233
complement(2200)-t, gdbSNP:35758587
2203+g, tdbSNP:70961723
complement(2258..2259)-, agcdbSNP:71755064
complement(2259..2260)-, agcdbSNP:10692370
2261..2262+, tgcdbSNP:70961724
complement(2271..2272)-, agcdbSNP:112711394
complement(2273..2274)-, agcdbSNP:72040689
complement(2282..2283)-, agcdbSNP:71674677
2283..2284+, gctdbSNP:41436147
complement(2403)-t, cdbSNP:41310464
2677+g, tdbSNP:41462146
Gene SymbolAPLN
Gene SynonymAPEL; XNPEP2
ChromosomeX
Locus MapXq25
All Transcripts NM_017413
Title Transcardiac gradients of circulating apelin: extraction by normal hearts vs. release by hearts failing due to pressure overload .
Author Helske,S., Kovanen,P.T., Lommi,J., Turto,H. and Kupari,M.
Journal J. Appl. Physiol. 109 (6), 1744-1748 (2010)
Title Apelin mediates the induction of profibrogenic genes in human hepatic stellate cells .
Author Melgar-Lesmes,P., Casals,G., Pauta,M., Ros,J., Reichenbach,V., Bataller,R., Morales-Ruiz,M. and Jimenez,W.
Journal Endocrinology 151 (11), 5306-5314 (2010)
Title Decreased plasma apelin levels in pubertal obese children .
Author Tapan,S., Tascilar,E., Abaci,A., Sonmez,A., Kilic,S., Erbil,M.K. and Ozcan,O.
Journal J. Pediatr. Endocrinol. Metab. 23 (10), 1039-1046 (2010)
Title Apelin plasma levels predict arrhythmia recurrence in patients with persistent atrial fibrillation .
Author Falcone,C., Buzzi,M.P., D'Angelo,A., Schirinzi,S., Falcone,R., Rordorf,R., Capettini,A.C., Landolina,M., Storti,C. and Pelissero,G.
Journal Int J Immunopathol Pharmacol 23 (3), 917-925 (2010)
Title Circulating and cardiac levels of apelin, the novel ligand of the orphan receptor APJ, in patients with heart failure .
Author Foldes,G., Horkay,F., Szokodi,I., Vuolteenaho,O., Ilves,M., Lindstedt,K.A., Mayranpaa,M., Sarman,B., Seres,L., Skoumal,R., Lako-Futo,Z., deChatel,R., Ruskoaho,H. and Toth,M.
Journal Biochem. Biophys. Res. Commun. 308 (3), 480-485 (2003)
Title Venous dilator effect of apelin, an endogenous peptide ligand for the orphan APJ receptor, in conscious rats .
Author Cheng,X., Cheng,X.S. and Pang,C.C.
Journal Eur. J. Pharmacol. 470 (3), 171-175 (2003)
Title Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin .
Author Medhurst,A.D., Jennings,C.A., Robbins,M.J., Davis,R.P., Ellis,C., Winborn,K.Y., Lawrie,K.W., Hervieu,G., Riley,G., Bolaky,J.E., Herrity,N.C., Murdock,P. and Darker,J.G.
Journal J. Neurochem. 84 (5), 1162-1172 (2003)
Title Apelin, the natural ligand of the orphan seven-transmembrane receptor APJ, inhibits human immunodeficiency virus type 1 entry .
Author Cayabyab,M., Hinuma,S., Farzan,M., Choe,H., Fukusumi,S., Kitada,C., Nishizawa,N., Hosoya,M., Nishimura,O., Messele,T., Pollakis,G., Goudsmit,J., Fujino,M. and Sodroski,J.
Journal J. Virol. 74 (24), 11972-11976 (2000)
Title Characterization of apelin, the ligand for the APJ receptor .
Author Lee,D.K., Cheng,R., Nguyen,T., Fan,T., Kariyawasam,A.P., Liu,Y., Osmond,D.H., George,S.R. and O'Dowd,B.F.
Journal J. Neurochem. 74 (1), 34-41 (2000)
Title Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor .
Author Tatemoto,K., Hosoya,M., Habata,Y., Fujii,R., Kakegawa,T., Zou,M.X., Kawamata,Y., Fukusumi,S., Hinuma,S., Kitada,C., Kurokawa,T., Onda,H. and Fujino,M.
Journal Biochem. Biophys. Res. Commun. 251 (2), 471-476 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878