• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_017519.2, 297139702
Length 9609 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA.
Product AT-rich interactive domain-containing protein 1B isoform 1
Comment

Summary: This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2012].


Transcript Variant: This variant (1) represents the shorter transcript and encodes the shorter isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_059989.2
CDS 1..6711
Misc Feature(1)1255..1269
Misc Feature(2)1255..1269
Misc Feature(3)1546..1548
Misc Feature(4)3160..3435
Misc Feature(5)4663..4665
Misc Feature(6)4675..4677
Misc Feature(7)5143..5145
Misc Feature(8)5329..5331
Misc Feature(9)5776..6546
Misc Feature(10)6106..6120
Exon (1)1543..1737
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (2)1738..1887
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (3)1888..1998
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (4)1999..2242
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (5)2243..2332
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (6)2333..2512
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (7)2513..2840
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (8)2841..2986
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (9)2987..3096
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (10)3097..3306
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (11)3307..3511
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (12)3512..3650
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (13)3651..3823
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (14)3824..3974
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (15)3975..4071
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (16)4072..4855
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (17)4856..4986
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (18)4987..9599
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Translation MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAME TGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQ QQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPA SGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPG YSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLN QLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMG AQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPY YSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPNHEDLNLIQQE RPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPG GPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGFM AGTQRNPQMAQYGPQQTGPSMSPHPSPGGQMHAGISSFQQSNSSGTYGPQMSQYGPQGNY SRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNM SSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLM ASSSPYSQPMNNSSSLMNTQAPPYSMAPAMVNSSAASVGLADMMSPGESKLPLPLKADGK EEGTPQPESKSKKSSSSTTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAV GKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFE CKIERGEEPPPEVFSTGDTKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPP TPASTPHGQMTPMQGGRSSTISVHDPFSDVSDSSFPKRNSMTPNAPYQQGMSMPDVMGRM PYEPNKDPFGGMRKVPGSSEPFMTQGQMPNSSMQDMYNQSPSGAMSNLGMGQRQQFPYGA SYDRRHEPYGQQYPGQGPPSGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYN MQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQ SSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWP SHVSQRQPYMSSSASMQPITRPPQPSYQTPPSLPNHISRAPSPASFQRSLENRMSPSKSP FLPSMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPVLKQRRKITSKDIVT PEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLID IFGILMEYEVGDPSQKALDHNAARKDDSQSLADDSGKEEEDAECIDDDEEDEEDEEEDSE KTESDEKSSIALTAPDAAADPKEKPKQASKFDKLPIKIVKKNNLFVVDRSDKLGRVQEFN SGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSAGRKKEQEGKGDSEEQQEKSI IATIDDVLSARPGALPEDANPGPQTESSKFPFGIQQAKSHRNIKLLEDEPRSRDETPLCT IAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQ TYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLL HWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYA TLVRYVGDRKNPVCREMSMALLSNLAQGDALAARAIAVQKGSIGNLISFLEDGVTMAQYQ QSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNS LVASVICDVLFQIGQL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
363+dbSNP:
363+a, gdbSNP:78253128
465+c, gdbSNP:200808642
675+c, gdbSNP:113758011
942+a, cdbSNP:184815562
945+a, cdbSNP:112474841
958+a, gdbSNP:201842850
984+a, gdbSNP:189230752
1285+a, gdbSNP:199948752
1522+c, tdbSNP:200682868
1552+dbSNP:
1552+a, gdbSNP:145785954
1561+a, gdbSNP:147794292
1592+c, tdbSNP:141260832
1598+a, gdbSNP:147088160
1632+a, g, tdbSNP:142939952
1678+a, gdbSNP:17318151
1693+a, cdbSNP:143370913
1705+g, tdbSNP:201244213
1714+a, gdbSNP:151093357
1745+dbSNP:
1745+c, tdbSNP:148382861
1791..1792+, cdbSNP:138196985
1798+c, tdbSNP:141395733
1823+c, tdbSNP:199949701
1831+c, tdbSNP:201038527
1842+c, gdbSNP:146312104
1863+c, tdbSNP:139595304
1893+dbSNP:
1893+a, gdbSNP:142897795
1938+c, tdbSNP:146240413
1956+a, tdbSNP:139125255
1959+c, tdbSNP:149931590
2031+dbSNP:
2031+a, gdbSNP:201290874
2037+a, gdbSNP:6912981
2070+c, tdbSNP:148700132
2133+a, gdbSNP:3734441
2259+dbSNP:
2259+a, gdbSNP:190653632
2299+a, gdbSNP:147784000
2339+dbSNP:
2339+g, tdbSNP:141219657
2360+c, tdbSNP:201156721
2380+c, tdbSNP:114201726
2405+c, tdbSNP:150140314
2477+c, tdbSNP:141030037
2482+a, gdbSNP:150249745
2504+g, tdbSNP:138934947
2528+dbSNP:
2528+a, cdbSNP:142272223
2566+a, gdbSNP:145635490
2626+c, gdbSNP:138254872
2636+a, gdbSNP:142773926
2646..2647+, gtgdbSNP:201979665
2709+c, gdbSNP:146077641
2823+c, gdbSNP:148749268
2856+dbSNP:
2856+c, tdbSNP:144894118
2857+c, tdbSNP:34786733
2939+a, tdbSNP:139620600
2943+a, gdbSNP:144558683
3054+dbSNP:
3054+c, tdbSNP:147853607
3134+dbSNP:
3134+c, tdbSNP:145054031
3270+c, tdbSNP:111368751
3273+c, tdbSNP:61736269
3291+c, tdbSNP:181686951
3300+g, tdbSNP:149068009
3360+dbSNP:
3360+c, tdbSNP:142391292
3420+a, gdbSNP:61745451
3449+c, tdbSNP:140710513
3560+dbSNP:
3560+a, gdbSNP:145857100
3589+c, gdbSNP:138482029
3637+a, gdbSNP:141190049
3668+dbSNP:
3668+c, tdbSNP:138218716
3707+c, tdbSNP:150196933
3721+a, gdbSNP:138784762
3812+a, gdbSNP:149389876
3822+a, gdbSNP:200230777
3862+dbSNP:
3862+a, gdbSNP:144029881
3907+a, gdbSNP:199674889
3937+c, tdbSNP:138785718
3962+a, gdbSNP:142808724
4041+dbSNP:
4041+a, gdbSNP:147424506
4044+c, tdbSNP:56139133
4051+a, gdbSNP:151115781
4092+dbSNP:
4092+c, tdbSNP:139785288
4097+c, tdbSNP:145012943
4131+c, tdbSNP:150516641
4167+a, gdbSNP:139512931
4186+a, gdbSNP:149702962
4195+g, tdbSNP:145516400
4201+c, gdbSNP:140639463
4208+a, gdbSNP:144424476
4233+a, gdbSNP:146625434
4306+a, gdbSNP:141461351
4308+c, tdbSNP:143236717
4323+a, gdbSNP:61745210
4401+c, tdbSNP:139903653
4404+g, tdbSNP:141783755
4425+c, gdbSNP:138412834
4438+a, gdbSNP:142788313
4456+a, tdbSNP:34870395
4457+c, tdbSNP:138181857
4485+c, tdbSNP:61747988
4506+c, tdbSNP:182287119
4557+c, tdbSNP:150010654
4581+a, gdbSNP:2068129
4593+a, gdbSNP:61738955
4597+c, tdbSNP:113347228
4693+a, gdbSNP:139214813
4793+g, tdbSNP:3210165
4869+dbSNP:
4869+a, gdbSNP:144385004
4891+, adbSNP:71704117
4917+a, gdbSNP:146620657
4976+a, gdbSNP:140177120
4982+c, tdbSNP:190027529
5060+dbSNP:
5060+a, gdbSNP:149841055
5103+c, tdbSNP:145867693
5136+a, cdbSNP:148922487
5139+c, tdbSNP:189662115
5147+a, gdbSNP:138020626
5168+a, cdbSNP:149518409
5181+, cgadbSNP:113820273
5215+a, cdbSNP:147690017
5217+c, tdbSNP:144279763
5264+c, tdbSNP:142466273
5270+c, tdbSNP:201137071
5271+c, tdbSNP:146982427
5359+g, tdbSNP:138149494
5399+a, gdbSNP:139181534
5503..5504+, cdbSNP:35441529
5507+c, gdbSNP:202194222
5508+c, tdbSNP:141738728
5517+c, tdbSNP:150153898
5518+a, gdbSNP:183921218
5547+a, gdbSNP:138658149
5551+a, gdbSNP:200305796
5556+g, tdbSNP:149235864
5592+c, tdbSNP:146192623
5606+c, gdbSNP:113818462
5724+c, tdbSNP:139174766
5763+c, tdbSNP:142499766
5781+g, tdbSNP:145972566
5883+c, tdbSNP:112703040
5910+c, tdbSNP:142416998
5937+a, gdbSNP:151317970
6032+c, tdbSNP:139429265
6048+c, gdbSNP:147444658
6182+c, tdbSNP:149978361
6192+c, tdbSNP:3812233
6303+a, gdbSNP:147679171
6307+c, gdbSNP:191761610
6516+a, gdbSNP:142956583
6574+a, tdbSNP:150698489
6596+a, gdbSNP:146468586
6615+c, tdbSNP:183572405
6911+a, gdbSNP:188107152
7043+a, gdbSNP:190173514
7328+a, gdbSNP:139857885
7414+a, gdbSNP:149835997
7423+a, gdbSNP:146453054
7478+a, gdbSNP:182437712
7485+a, gdbSNP:7765775
7535+c, tdbSNP:139366986
7536..7537+, ttdbSNP:10679630
7692..7693+, adbSNP:11387819
7693+a, gdbSNP:186673230
7698..7699+, adbSNP:35660733
7698+, adbSNP:200471587
7844+a, tdbSNP:11858
7956+a, gdbSNP:191127408
7989+c, tdbSNP:148830183
8094+a, gdbSNP:143593587
8275+c, tdbSNP:151019751
8288+a, gdbSNP:55734286
8299+c, tdbSNP:140822829
8321+c, tdbSNP:146042542
8444+a, cdbSNP:200201116
8508+a, gdbSNP:185716192
8710+a, gdbSNP:111680620
8980+g, tdbSNP:189049586
8993+a, gdbSNP:192960709
9322+a, gdbSNP:185343380
9347+c, gdbSNP:4419680
9390+a, cdbSNP:1133802
9392+a, gdbSNP:188954891
9462+c, tdbSNP:143065191
9464..9465+, tdbSNP:111887732
9465..9466+, tdbSNP:71773024
9465+, tdbSNP:201177667
9527..9528+, adbSNP:71898369
9527+, adbSNP:201959218
Gene SymbolARID1B
Gene Synonym6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Chromosome6
Locus Map6q25.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_020732 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 2, mRNA. On-demand TBD TBD
Title Integrated genomic analyses identify ARID1A and ARID1B alterations in the childhood cancer neuroblastoma .
Author Sausen,M., Leary,R.J., Jones,S., Wu,J., Reynolds,C.P., Liu,X., Blackford,A., Parmigiani,G., Diaz,L.A. Jr., Papadopoulos,N., Vogelstein,B., Kinzler,K.W., Velculescu,V.E. and Hogarty,M.D.
Journal Nat. Genet. 45 (1), 12-17 (2013)
Title Mutations in SWI/SNF chromatin remodeling complex gene ARID1B cause Coffin-Siris syndrome .
Author Santen,G.W., Aten,E., Sun,Y., Almomani,R., Gilissen,C., Nielsen,M., Kant,S.G., Snoeck,I.N., Peeters,E.A., Hilhorst-Hofstee,Y., Wessels,M.W., den Hollander,N.S., Ruivenkamp,C.A., van Ommen,G.J., Breuning,M.H., den Dunnen,J.T., van Haeringen,A. and Kriek,M.
Journal Nat. Genet. 44 (4), 379-380 (2012)
Title Haploinsufficiency of ARID1B, a member of the SWI/SNF-a chromatin-remodeling complex, is a frequent cause of intellectual disability .
Author Hoyer,J., Ekici,A.B., Endele,S., Popp,B., Zweier,C., Wiesener,A., Wohlleber,E., Dufke,A., Rossier,E., Petsch,C., Zweier,M., Gohring,I., Zink,A.M., Rappold,G., Schrock,E., Wieczorek,D., Riess,O., Engels,H., Rauch,A. and Reis,A.
Journal Am. J. Hum. Genet. 90 (3), 565-572 (2012)
Title Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations .
Author Wu,C., Miao,X., Huang,L., Che,X., Jiang,G., Yu,D., Yang,X., Cao,G., Hu,Z., Zhou,Y., Zuo,C., Wang,C., Zhang,X., Zhou,Y., Yu,X., Dai,W., Li,Z., Shen,H., Liu,L., Chen,Y., Zhang,S., Wang,X., Zhai,K., Chang,J., Liu,Y., Sun,M., Cao,W., Gao,J., Ma,Y., Zheng,X., Cheung,S.T., Jia,Y., Xu,J., Tan,W., Zhao,P., Wu,T., Wang,C. and Lin,D.
Journal Nat. Genet. 44 (1), 62-66 (2012)
Title Reduced transcript expression of genes affected by inherited and de novo CNVs in autism .
Author Nord,A.S., Roeb,W., Dickel,D.E., Walsh,T., Kusenda,M., O'Connor,K.L., Malhotra,D., McCarthy,S.E., Stray,S.M., Taylor,S.M., Sebat,J., King,B., King,M.C. and McClellan,J.M.
Journal Eur. J. Hum. Genet. 19 (6), 727-731 (2011)
Title Cloning and characterization of hELD/OSA1, a novel BRG1 interacting protein .
Author Hurlstone,A.F., Olave,I.A., Barker,N., van Noort,M. and Clevers,H.
Journal Biochem. J. 364 (PT 1), 255-264 (2002)
Title SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones .
Author Kato,H., Tjernberg,A., Zhang,W., Krutchinsky,A.N., An,W., Takeuchi,T., Ohtsuki,Y., Sugano,S., de Bruijn,D.R., Chait,B.T. and Roeder,R.G.
Journal J. Biol. Chem. 277 (7), 5498-5505 (2002)
Title The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes .
Author Xue,Y., Canman,J.C., Lee,C.S., Nie,Z., Yang,D., Moreno,G.T., Young,M.K., Salmon,E.D. and Wang,W.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (24), 13015-13020 (2000)
Title Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits .
Author Phelan,M.L., Sif,S., Narlikar,G.J. and Kingston,R.E.
Journal Mol. Cell 3 (2), 247-253 (1999)
Title Cloning of the gene for spinocerebellar ataxia 2 reveals a locus with high sensitivity to expanded CAG/glutamine repeats .
Author Imbert,G., Saudou,F., Yvert,G., Devys,D., Trottier,Y., Garnier,J.M., Weber,C., Mandel,J.L., Cancel,G., Abbas,N., Durr,A., Didierjean,O., Stevanin,G., Agid,Y. and Brice,A.
Journal Nat. Genet. 14 (3), 285-291 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.