• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21347 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand TBD -1
OHu21347C Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. Customized vector On-demand TBD -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_017519.2, 297139702
Length 6711 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA.
Product AT-rich interactive domain-containing protein 1B isoform 1
Comment

Summary: This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2012].


Transcript Variant: This variant (1) represents the shorter transcript and encodes the shorter isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_059989.2
CDS 1..6711
Misc Feature(1)4..6
Misc Feature(2)4..6
Misc Feature(3)1255..1269
Misc Feature(4)1546..1548
Misc Feature(5)2092..>2292
Misc Feature(6)3160..3435
Misc Feature(7)4663..4665
Misc Feature(8)4675..4677
Misc Feature(9)5143..5145
Misc Feature(10)5329..5331
Misc Feature(11)5776..6546
Misc Feature(12)6106..6120
Exon (1)1543..1737
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (2)1738..1887
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (3)1888..1998
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (4)1999..2242
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (5)2243..2332
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (6)2333..2512
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (7)2513..2840
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (8)2841..2986
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (9)2987..3096
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (10)3097..3306
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (11)3307..3511
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (12)3512..3650
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (13)3651..3823
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (14)3824..3974
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (15)3975..4071
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (16)4072..4855
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (17)4856..4986
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Exon (18)4987..9599
Gene:ARID1B
Gene Synonym:6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Translation MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAME TGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQ QQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPA SGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPG YSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLN QLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMG AQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPY YSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPNHEDLNLIQQE RPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPG GPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGFM AGTQRNPQMAQYGPQQTGPSMSPHPSPGGQMHAGISSFQQSNSSGTYGPQMSQYGPQGNY SRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNM SSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLM ASSSPYSQPMNNSSSLMNTQAPPYSMAPAMVNSSAASVGLADMMSPGESKLPLPLKADGK EEGTPQPESKSKKSSSSTTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAV GKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFE CKIERGEEPPPEVFSTGDTKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPP TPASTPHGQMTPMQGGRSSTISVHDPFSDVSDSSFPKRNSMTPNAPYQQGMSMPDVMGRM PYEPNKDPFGGMRKVPGSSEPFMTQGQMPNSSMQDMYNQSPSGAMSNLGMGQRQQFPYGA SYDRRHEPYGQQYPGQGPPSGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYN MQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQ SSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWP SHVSQRQPYMSSSASMQPITRPPQPSYQTPPSLPNHISRAPSPASFQRSLENRMSPSKSP FLPSMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPVLKQRRKITSKDIVT PEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLID IFGILMEYEVGDPSQKALDHNAARKDDSQSLADDSGKEEEDAECIDDDEEDEEDEEEDSE KTESDEKSSIALTAPDAAADPKEKPKQASKFDKLPIKIVKKNNLFVVDRSDKLGRVQEFN SGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSAGRKKEQEGKGDSEEQQEKSI IATIDDVLSARPGALPEDANPGPQTESSKFPFGIQQAKSHRNIKLLEDEPRSRDETPLCT IAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQ TYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLL HWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYA TLVRYVGDRKNPVCREMSMALLSNLAQGDALAARAIAVQKGSIGNLISFLEDGVTMAQYQ QSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNS LVASVICDVLFQIGQL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
97+dbSNP:
97+a, gdbSNP:371680791
146+a, cdbSNP:375486386
183+a, gdbSNP:369887127
252+c, gdbSNP:372726215
286+a, cdbSNP:374989034
363+a, gdbSNP:78253128
444+g, tdbSNP:370106545
465+c, gdbSNP:200808642
675+c, gdbSNP:113758011
736+a, gdbSNP:375160616
942+a, cdbSNP:184815562
945+a, cdbSNP:112474841
958+a, gdbSNP:201842850
984+a, gdbSNP:189230752
1285+a, gdbSNP:199948752
1522+c, tdbSNP:200682868
1552+dbSNP:
1552+a, gdbSNP:145785954
1561+a, gdbSNP:147794292
1575+a, gdbSNP:267600875
1592+c, tdbSNP:141260832
1598+a, gdbSNP:147088160
1632+a, g, tdbSNP:142939952
1678+a, gdbSNP:17318151
1693+a, cdbSNP:143370913
1705+g, tdbSNP:201244213
1714+a, gdbSNP:151093357
1745+dbSNP:
1745+c, tdbSNP:148382861
1791..1792+, cdbSNP:138196985
1798+c, tdbSNP:141395733
1823+c, tdbSNP:199949701
1824+a, gdbSNP:370068335
1825+c, tdbSNP:372781930
1831+c, tdbSNP:201038527
1842+c, gdbSNP:146312104
1854+a, gdbSNP:376964478
1863+c, tdbSNP:139595304
1864+c, tdbSNP:387907142
1879+c, tdbSNP:372690657
1881+a, gdbSNP:374876774
1893+dbSNP:
1893+a, gdbSNP:142897795
1934+c, tdbSNP:376595068
1938+c, tdbSNP:146240413
1956+a, tdbSNP:139125255
1959+c, tdbSNP:149931590
2030+dbSNP:
2030+c, tdbSNP:373508866
2031+a, gdbSNP:201290874
2037+a, gdbSNP:6912981
2058+a, cdbSNP:376143843
2070+c, tdbSNP:148700132
2079+a, gdbSNP:370910542
2092+a, gdbSNP:374648940
2096+a, gdbSNP:368202669
2130+c, tdbSNP:370364530
2133+a, gdbSNP:3734441
2157+a, gdbSNP:374696557
2159+c, gdbSNP:367698478
2245+dbSNP:
2245+a, tdbSNP:372730587
2259+a, gdbSNP:190653632
2299+a, gdbSNP:147784000
2310+a, gdbSNP:368362137
2339+dbSNP:
2339+g, tdbSNP:141219657
2360+c, tdbSNP:201156721
2380+c, tdbSNP:114201726
2405+c, tdbSNP:150140314
2406+a, gdbSNP:374691223
2477+c, tdbSNP:141030037
2482+a, gdbSNP:150249745
2487+a, gdbSNP:368988882
2504+g, tdbSNP:138934947
2566+dbSNP:
2566+a, gdbSNP:145635490
2607+g, tdbSNP:376497842
2626+c, gdbSNP:138254872
2646..2647+, gtgdbSNP:201979665
2709+c, gdbSNP:146077641
2799+c, tdbSNP:374572368
2800+a, gdbSNP:377633743
2823+c, gdbSNP:148749268
2856+dbSNP:
2856+c, tdbSNP:144894118
2857+c, tdbSNP:34786733
2879+c, tdbSNP:370071892
2895+a, cdbSNP:373256784
2939+a, tdbSNP:139620600
2942+c, tdbSNP:377351099
2943+a, gdbSNP:144558683
2945+c, tdbSNP:370190261
3011+dbSNP:
3011+c, tdbSNP:371523255
3054+c, tdbSNP:147853607
3055+a, gdbSNP:375023508
3079+c, tdbSNP:368880015
3099+dbSNP:
3099+a, gdbSNP:373653398
3147+a, gdbSNP:373641381
3180+c, tdbSNP:371828409
3184+c, tdbSNP:387907144
3218+c, tdbSNP:377588212
3238+a, gdbSNP:370283707
3249+g, tdbSNP:374705142
3255+a, gdbSNP:376995038
3265+c, tdbSNP:387907141
3270+c, g, tdbSNP:111368751
3273+c, tdbSNP:61736269
3290+g, tdbSNP:375581771
3291+c, tdbSNP:181686951
3360+dbSNP:
3360+c, tdbSNP:142391292
3420+a, gdbSNP:61745451
3468+c, tdbSNP:369218715
3555+dbSNP:
3555+c, tdbSNP:372186962
3560+a, gdbSNP:145857100
3589+c, gdbSNP:138482029
3637+a, gdbSNP:141190049
3638+c, tdbSNP:376806897
3654+dbSNP:
3654+c, tdbSNP:369035728
3668+c, tdbSNP:138218716
3672+c, tdbSNP:373881952
3707+c, tdbSNP:150196933
3721+a, gdbSNP:138784762
3731+a, gdbSNP:376071880
3732+c, tdbSNP:370523060
3791+c, gdbSNP:374517532
3812+a, gdbSNP:149389876
3822+a, gdbSNP:200230777
3846+dbSNP:
3846+c, tdbSNP:368341224
3851+c, tdbSNP:371538726
3852+c, gdbSNP:374823620
3862+a, gdbSNP:144029881
3880+c, tdbSNP:387907140
3897+a, gdbSNP:367653751
3906+c, tdbSNP:371872657
3907+a, gdbSNP:199674889
3937+c, tdbSNP:138785718
3938+a, gdbSNP:370064281
3962+a, gdbSNP:142808724
3966+c, tdbSNP:372767127
4032+dbSNP:
4032+a, gdbSNP:374835455
4041+a, gdbSNP:147424506
4044+c, tdbSNP:56139133
4051+a, gdbSNP:151115781
4070+c, tdbSNP:367809905
4092+dbSNP:
4092+c, tdbSNP:139785288
4097+c, tdbSNP:145012943
4101+c, tdbSNP:377021700
4119+c, tdbSNP:369640779
4131+c, tdbSNP:150516641
4167+a, gdbSNP:139512931
4172+a, gdbSNP:372833448
4186+a, gdbSNP:149702962
4195+g, tdbSNP:145516400
4201+c, gdbSNP:140639463
4208+a, gdbSNP:144424476
4216+a, cdbSNP:376225642
4218+c, gdbSNP:368993084
4233+a, gdbSNP:146625434
4293+a, gdbSNP:373191607
4306+a, gdbSNP:141461351
4308+c, tdbSNP:143236717
4309+a, gdbSNP:376207220
4313+c, tdbSNP:370889837
4323+a, gdbSNP:61745210
4385+a, gdbSNP:373500669
4401+c, tdbSNP:139903653
4404+g, tdbSNP:141783755
4421+c, tdbSNP:370838091
4425+c, gdbSNP:138412834
4438+a, gdbSNP:142788313
complement(4456)-t, adbSNP:34870395
4457+c, tdbSNP:138181857
4485+a, gdbSNP:386444014
4485+c, tdbSNP:61747988
4494+a, gdbSNP:373910693
4506+c, tdbSNP:182287119
4533+a, gdbSNP:368163089
4557+c, tdbSNP:150010654
complement(4581)-g, adbSNP:2068129
4593+a, gdbSNP:61738955
4597+c, tdbSNP:113347228
4609+a, gdbSNP:370174322
4632+a, gdbSNP:374125873
4655+a, gdbSNP:367764610
4693+a, gdbSNP:139214813
4793+g, tdbSNP:3210165
4815+a, gdbSNP:371430687
4849+c, gdbSNP:375949587
4902+dbSNP:
4902+c, tdbSNP:372621575
4917+a, gdbSNP:146620657
4976+a, gdbSNP:140177120
4982+c, tdbSNP:190027529
5056+dbSNP:
5056+a, gdbSNP:369339813
5060+a, gdbSNP:149841055
5103+c, tdbSNP:145867693
5136+a, cdbSNP:148922487
5139+c, tdbSNP:189662115
5147+a, gdbSNP:138020626
5168+a, cdbSNP:149518409
5179..5181+, gacdbSNP:374755339
5184..5186+, cgadbSNP:113820273
5185+a, gdbSNP:374680141
5193+c, tdbSNP:368980689
5215+a, cdbSNP:147690017
5217+c, tdbSNP:144279763
5218+a, gdbSNP:376495346
5233+a, gdbSNP:370789207
5264+c, tdbSNP:142466273
5270+c, tdbSNP:201137071
5271+c, tdbSNP:146982427
5290+a, tdbSNP:387907143
5325+a, gdbSNP:374294418
5359+g, tdbSNP:138149494
5384+a, gdbSNP:376758952
5399+a, gdbSNP:139181534
5495+a, gdbSNP:374035954
5507+c, gdbSNP:202194222
5508..5509+, cdbSNP:35441529
5508+c, tdbSNP:141738728
5517+c, tdbSNP:150153898
5518+a, gdbSNP:183921218
5547+a, gdbSNP:138658149
5551+a, gdbSNP:200305796
5592+c, tdbSNP:146192623
5606+c, gdbSNP:113818462
5655+c, tdbSNP:376113162
5684+a, gdbSNP:368646411
5724+c, tdbSNP:139174766
5763+c, tdbSNP:142499766
5766+g, tdbSNP:372334858
5781+a, gdbSNP:145972566
5832+c, tdbSNP:376317262
5883+c, tdbSNP:112703040
5910+c, tdbSNP:142416998
5936+c, tdbSNP:368420323
5937+a, gdbSNP:151317970
6032+c, tdbSNP:139429265
6033+a, gdbSNP:371980859
6048+c, gdbSNP:147444658
6083+c, tdbSNP:375017809
6117+a, gdbSNP:369259342
6182+c, tdbSNP:149978361
6183+a, gdbSNP:373301793
complement(6192)-t, cdbSNP:3812233
6303+a, gdbSNP:147679171
6307+c, gdbSNP:191761610
6465+c, gdbSNP:377350616
6516+a, gdbSNP:142956583
6574+a, tdbSNP:150698489
6588+c, tdbSNP:368868154
6595+c, tdbSNP:371461578
6596+a, gdbSNP:146468586
6611+c, tdbSNP:375389356
6615+c, tdbSNP:183572405
6714+c, tdbSNP:367616374
6911+a, gdbSNP:188107152
6929..6930+, tdbSNP:370046956
6939+, tdbSNP:376411414
7043+a, gdbSNP:190173514
7328+a, gdbSNP:139857885
7414+a, gdbSNP:149835997
7423+a, gdbSNP:146453054
7478+a, gdbSNP:182437712
7485+a, gdbSNP:7765775
7486+c, tdbSNP:377406756
7535+c, tdbSNP:139366986
7572+c, tdbSNP:371782923
7693+a, gdbSNP:186673230
7698+, adbSNP:200471587
7844+a, tdbSNP:11858
7956+a, gdbSNP:191127408
7989+c, tdbSNP:148830183
8094+a, gdbSNP:143593587
8110+a, cdbSNP:373433267
8275+c, tdbSNP:151019751
8288+a, gdbSNP:55734286
8299+c, tdbSNP:140822829
complement(8321)-t, cdbSNP:146042542
8444+a, cdbSNP:200201116
8508+a, gdbSNP:185716192
8527+a, gdbSNP:376461193
8710+a, gdbSNP:111680620
8808+a, gdbSNP:373798478
8819+a, gdbSNP:367557504
8980+g, tdbSNP:189049586
8993+a, gdbSNP:192960709
9322+a, gdbSNP:185343380
9347+c, gdbSNP:4419680
9390+a, cdbSNP:1133802
9392+a, gdbSNP:188954891
9462+c, tdbSNP:143065191
9464..9465+, tdbSNP:111887732
9465+, tdbSNP:201177667
9527+, adbSNP:201959218
9581+a, gdbSNP:370688518
Gene SymbolARID1B
Gene Synonym6A3-5; BAF250B; BRIGHT; DAN15; ELD/OSA1; MRD12; OSA2; P250R
Chromosome6
Locus Map6q25.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
NM_017519 Homo sapiens AT rich interactive domain 1B (SWI1-like) (ARID1B), transcript variant 1, mRNA. On-demand TBD TBD
Title ARID1B is a specific vulnerability in ARID1A-mutant cancers .
Author Helming KC, Wang X, Wilson BG, Vazquez F, Haswell JR, Manchester HE, Kim Y, Kryukov GV, Ghandi M, Aguirre AJ, Jagani Z, Wang Z, Garraway LA, Hahn WC and Roberts CW.
Journal Nat. Med. 20 (3), 251-254 (2014)
Title ARID1B, a member of the human SWI/SNF chromatin remodeling complex, exhibits tumour-suppressor activities in pancreatic cancer cell lines .
Author Khursheed M, Kolla JN, Kotapalli V, Gupta N, Gowrishankar S, Uppin SG, Sastry RA, Koganti S, Sundaram C, Pollack JR and Bashyam MD.
Journal Br. J. Cancer 108 (10), 2056-2062 (2013)
Title Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations .
Author O'Seaghdha CM, Wu H, Yang Q, Kapur K, Guessous I, Zuber AM, Kottgen A, Stoudmann C, Teumer A, Kutalik Z, Mangino M, Dehghan A, Zhang W, Eiriksdottir G, Li G, Tanaka T, Portas L, Lopez LM, Hayward C, Lohman K, Matsuda K, Padmanabhan S, Firsov D, Sorice R, Ulivi S, Brockhaus AC, Kleber ME, Mahajan A, Ernst FD, Gudnason V, Launer LJ, Mace A, Boerwinckle E, Arking DE, Tanikawa C, Nakamura Y, Brown MJ, Gaspoz JM, Theler JM, Siscovick DS, Psaty BM, Bergmann S, Vollenweider P, Vitart V, Wright AF, Zemunik T, Boban M, Kolcic I, Navarro P, Brown EM, Estrada K, Ding J, Harris TB, Bandinelli S, Hernandez D, Singleton AB, Girotto G, Ruggiero D, d'Adamo AP, Robino A, Meitinger T, Meisinger C, Davies G, Starr JM, Chambers JC, Boehm BO, Winkelmann BR, Huang J, Murgia F, Wild SH, Campbell H, Morris AP, Franco OH, Hofman A, Uitterlinden AG, Rivadeneira F, Volker U, Hannemann A, Biffar R, Hoffmann W, Shin SY, Lescuyer P, Henry H, Schurmann C, Munroe PB, Gasparini P, Pirastu N, Ciullo M, Gieger C, Marz W, Lind L, Spector TD, Smith AV, Rudan I, Wilson JF, Polasek O, Deary IJ, Pirastu M, Ferrucci L, Liu Y, Kestenbaum B, Kooner JS, Witteman JC, Nauck M, Kao WH, Wallaschofski H, Bonny O, Fox CS and Bochud M.
Journal PLoS Genet. 9 (9), E1003796 (2013)
Title Genome-wide association study of sensory disturbances in the inferior alveolar nerve after bilateral sagittal split ramus osteotomy .
Author Kobayashi D, Nishizawa D, Takasaki Y, Kasai S, Kakizawa T, Ikeda K and Fukuda K.
Journal Mol Pain 9, 34 (2013)
Title Cloning and characterization of hELD/OSA1, a novel BRG1 interacting protein .
Author Hurlstone AF, Olave IA, Barker N, van Noort M and Clevers H.
Journal Biochem. J. 364 (PT 1), 255-264 (2002)
Title SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones .
Author Kato H, Tjernberg A, Zhang W, Krutchinsky AN, An W, Takeuchi T, Ohtsuki Y, Sugano S, de Bruijn DR, Chait BT and Roeder RG.
Journal J. Biol. Chem. 277 (7), 5498-5505 (2002)
Title The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes .
Author Xue Y, Canman JC, Lee CS, Nie Z, Yang D, Moreno GT, Young MK, Salmon ED and Wang W.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (24), 13015-13020 (2000)
Title Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits .
Author Phelan ML, Sif S, Narlikar GJ and Kingston RE.
Journal Mol. Cell 3 (2), 247-253 (1999)
Title Cloning of the gene for spinocerebellar ataxia 2 reveals a locus with high sensitivity to expanded CAG/glutamine repeats .
Author Imbert G, Saudou F, Yvert G, Devys D, Trottier Y, Garnier JM, Weber C, Mandel JL, Cancel G, Abbas N, Durr A, Didierjean O, Stevanin G, Agid Y and Brice A.
Journal Nat. Genet. 14 (3), 285-291 (1996)
Title Coffin-Siris Syndrome .
Author Schrier Vergano,S., Santen,G., Wieczorek,D., Wollnik,B., Matsumoto,N. and Deardorff,M.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.