• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tripartite motif containing 44 (TRIM44), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu44905 Homo sapiens tripartite motif containing 44 (TRIM44), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu44905C Homo sapiens tripartite motif containing 44 (TRIM44), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_017583.4, 205277436
Length 1035 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens tripartite motif containing 44 (TRIM44), mRNA.
Product tripartite motif-containing protein 44
Comment

Summary: This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC013166.1, BC024031.2 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_060053.2
CDS 308..1342
Misc Feature(1)836..952
Misc Feature(2)836..952
Misc Feature(3)order(842..844,851..853,908..910,926..928)
Exon (1)1..976
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (2)977..1054
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (3)1055..1294
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (4)1295..1314
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (5)1315..4337
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Translation MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEY VHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDE SDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCP DHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVER LKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
79+dbSNP:
79+a, gdbSNP:35980563
105+g, tdbSNP:34549335
140+c, gdbSNP:149734513
279+c, gdbSNP:112136832
282+a, gdbSNP:12804197
284+c, gdbSNP:12803873
286+c, tdbSNP:201360919
294+c, gdbSNP:375521655
355+c, gdbSNP:141513598
370+c, tdbSNP:146195111
376+a, cdbSNP:201198741
379+c, tdbSNP:368966716
407+a, cdbSNP:373205820
418+c, tdbSNP:139199019
442+c, tdbSNP:372673821
complement(481)-g, adbSNP:34392570
481+c, tdbSNP:386582474
498+a, cdbSNP:377117775
524+g, tdbSNP:375647261
529+c, gdbSNP:369326810
579+c, tdbSNP:143958152
610+a, gdbSNP:373825472
626+a, tdbSNP:377623025
634+a, gdbSNP:148551696
660+a, gdbSNP:142324712
700+a, gdbSNP:377515645
724+a, cdbSNP:369333767
730+c, tdbSNP:372734654
733+a, gdbSNP:377371808
759+c, tdbSNP:370656718
792+a, gdbSNP:375549195
793+a, cdbSNP:377051977
822+a, gdbSNP:371240207
835+a, gdbSNP:374943919
847+a, gdbSNP:367638428
849+a, gdbSNP:202091709
859+c, tdbSNP:146343301
886+c, tdbSNP:139171417
895+c, tdbSNP:199988558
918+c, tdbSNP:142660136
923+g, tdbSNP:201122755
955+c, tdbSNP:372123217
1007+dbSNP:
1007+a, cdbSNP:372846940
1008+c, tdbSNP:144607373
1062+dbSNP:
1062+g, tdbSNP:149318521
1148+g, tdbSNP:181145347
1222+a, gdbSNP:150664095
1234+c, gdbSNP:185989513
1248+a, gdbSNP:61758104
1297+dbSNP:
1297+c, tdbSNP:371369046
1298+a, gdbSNP:181043254
1299+a, tdbSNP:138227319
1300+c, tdbSNP:374271699
1319+dbSNP:
1319+g, tdbSNP:374372663
1341+a, gdbSNP:200834184
1365+a, g, tdbSNP:61881297
1500+a, gdbSNP:375916691
1654+a, gdbSNP:146748492
1680+a, gdbSNP:112757510
1689+a, gdbSNP:187376505
1754+a, gdbSNP:190760306
1862+c, tdbSNP:182988466
1870+a, cdbSNP:369365527
1934+a, gdbSNP:111289311
1996+a, gdbSNP:187239871
2064+a, gdbSNP:140579576
2174+c, tdbSNP:373417708
2215+c, tdbSNP:190141144
2389+a, cdbSNP:376676350
complement(2410)-g, cdbSNP:597254
2510+c, gdbSNP:150302930
2633+a, gdbSNP:375917841
complement(2650)-t, cdbSNP:137870591
2652+g, tdbSNP:377765849
2668+c, tdbSNP:370266411
complement(2714)-g, adbSNP:12809
2729+g, tdbSNP:182857721
complement(2778)-t, cdbSNP:142335805
complement(2885)-t, cdbSNP:6709
2938+a, gdbSNP:187453708
2955+c, tdbSNP:145978710
2961+c, tdbSNP:367758131
2990+a, gdbSNP:192678756
3164..3165+, adbSNP:71457390
3182..3183+, aaaaa, aaaaaa, aaaaaaaadbSNP:56255775
3183+a, gdbSNP:376564706
3184+a, cdbSNP:367785693
3205+a, gdbSNP:185728796
3231+a, gdbSNP:188966081
3369+g, tdbSNP:202110872
3407+a, tdbSNP:61188486
complement(3414)-t, gdbSNP:138590624
3450+a, gdbSNP:2956335
3482+a, gdbSNP:141792110
3554+g, tdbSNP:374790007
3661+a, gdbSNP:192232885
3744+a, gdbSNP:74744989
3771+g, tdbSNP:375386514
3885+c, gdbSNP:184216022
3982+c, tdbSNP:144527625
4028+c, tdbSNP:148486848
4042+c, gdbSNP:188626075
4053+g, tdbSNP:200851723
4094+a, tdbSNP:11538402
4098+a, gdbSNP:111908180
4145+a, gdbSNP:16927957
4156+a, cdbSNP:141767985
4158+c, tdbSNP:181059511
4280+a, gdbSNP:150584314
Gene SymbolTRIM44
Gene SynonymDIPB; HSA249128; MC7
Chromosome11
Locus Map11p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_017583 Homo sapiens tripartite motif containing 44 (TRIM44), mRNA. On-demand $219.00 7-9
XM_006718254 PREDICTED: Homo sapiens tripartite motif containing 44 (TRIM44), transcript variant X1, mRNA. On-demand $159.00 7-9
Title Novel function of Trim44 promotes an antiviral response by stabilizing VISA .
Author Yang B, Wang J, Wang Y, Zhou H, Wu X, Tian Z and Sun B.
Journal J. Immunol. 190 (7), 3613-3619 (2013)
Title Overexpression of TRIM44 contributes to malignant outcome in gastric carcinoma .
Author Kashimoto K, Komatsu S, Ichikawa D, Arita T, Konishi H, Nagata H, Takeshita H, Nishimura Y, Hirajima S, Kawaguchi T, Shiozaki A, Fujiwara H, Okamoto K, Tsuda H and Otsuji E.
Journal Cancer Sci. 103 (11), 2021-2026 (2012)
Title Genomewide association study of movement-related adverse antipsychotic effects .
Author Aberg K, Adkins DE, Bukszar J, Webb BT, Caroff SN, Miller DD, Sebat J, Stroup S, Fanous AH, Vladimirov VI, McClay JL, Lieberman JA, Sullivan PF and van den Oord EJ.
Journal Biol. Psychiatry 67 (3), 279-282 (2010)
Title TRIM44 interacts with and stabilizes terf, a TRIM ubiquitin E3 ligase .
Author Urano T, Usui T, Takeda S, Ikeda K, Okada A, Ishida Y, Iwayanagi T, Otomo J, Ouchi Y and Inoue S.
Journal Biochem. Biophys. Res. Commun. 383 (2), 263-268 (2009)
Title The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing .
Author Miele A, Medina R, van Wijnen AJ, Stein GS and Stein JL.
Journal J. Cell. Biochem. 102 (1), 136-148 (2007)
Title Human chromosome 11 DNA sequence and analysis including novel gene identification .
Author Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES and Sakaki Y.
Journal Nature 440 (7083), 497-500 (2006)
Title Transcriptome analysis of human gastric cancer .
Author Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS and Kim NS.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title The tripartite motif family identifies cell compartments .
Author Reymond A, Meroni G, Fantozzi A, Merla G, Cairo S, Luzi L, Riganelli D, Zanaria E, Messali S, Cainarca S, Guffanti A, Minucci S, Pelicci PG and Ballabio A.
Journal EMBO J. 20 (9), 2140-2151 (2001)
Title Isolation of a mouse brain cDNA expressed in developing neuroblasts and mature neurons .
Author Boutou E, Matsas R and Mamalaki A.
Journal Brain Res. Mol. Brain Res. 86 (1-2), 153-167 (2001)
Title A 7.5 Mb sequence-ready PAC contig and gene expression map of human chromosome 11p13-p14.1 .
Author Gawin B, Niederfuhr A, Schumacher N, Hummerich H, Little PF and Gessler M.
Journal Genome Res. 9 (11), 1074-1086 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.