• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tripartite motif containing 44 (TRIM44), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_017583 Homo sapiens tripartite motif containing 44 (TRIM44), mRNA. Full Lenth $1517.95
ORF Sequence $300.15


RefSeq Version NM_017583.4, 205277436
Length 4337 bp
Structure linear
Update Date 28-JAN-2011
Organism Homo sapiens (human)
Definition Homo sapiens tripartite motif containing 44 (TRIM44), mRNA.
Product tripartite motif-containing protein 44
Comment

Summary: This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq].

RefSeq NP_060053.2
CDS 308..1342
Exon (1)1..976
Exon (2)1..976
Exon (3)977..1054
Exon (4)1055..1294
Exon (5)1295..1312
Exon (6)1313..4337
Translation MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEY VHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDE SDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCP DHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVER LKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
79+a, gdbSNP:35980563
105+g, tdbSNP:34549335
279+c, gdbSNP:112136832
282+a, gdbSNP:12804197
284+c, gdbSNP:12803873
complement(481)-g, adbSNP:34392570
1248+a, gdbSNP:61758104
1365+a, tdbSNP:61881297
1414+c, tdbSNP:77871749
1680+a, gdbSNP:112757510
1934+a, gdbSNP:111289311
complement(2410)-g, cdbSNP:597254
complement(2714)-g, adbSNP:12809
complement(2885)-t, cdbSNP:6709
3164..3165+, adbSNP:71457390
3172..3173+, aaaaaadbSNP:10636954
3173..3174+, aaaaaadbSNP:33979976
3174..3175+, aaaaaadbSNP:10674327
3175..3176+, aaaaaadbSNP:34294341
3182..3183+, aaaaaadbSNP:56255775
3183..3184+, aaaaadbSNP:71977614
complement(3235)-t, adbSNP:41498552
3407+a, tdbSNP:61188486
3450+a, gdbSNP:2956335
3744+a, gdbSNP:74744989
4094+a, tdbSNP:11538402
4098+a, gdbSNP:111908180
4145+a, gdbSNP:16927957
Gene SymbolTRIM44
Gene SynonymDIPB; HSA249128; MC7; MGC3490
Chromosome11
Locus Map11p13
All Transcripts NM_017583
Title Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score .
Author Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R.
Journal Mol. Med. 16 (7-8), 247-253 (2010)
Title Genomewide association study of movement-related adverse antipsychotic effects .
Author Aberg,K., Adkins,D.E., Bukszar,J., Webb,B.T., Caroff,S.N., Miller del,D., Sebat,J., Stroup,S., Fanous,A.H., Vladimirov,V.I., McClay,J.L., Lieberman,J.A., Sullivan,P.F. and van den Oord,E.J.
Journal Biol. Psychiatry 67 (3), 279-282 (2010)
Title TRIM44 interacts with and stabilizes terf, a TRIM ubiquitin E3 ligase .
Author Urano,T., Usui,T., Takeda,S., Ikeda,K., Okada,A., Ishida,Y., Iwayanagi,T., Otomo,J., Ouchi,Y. and Inoue,S.
Journal Biochem. Biophys. Res. Commun. 383 (2), 263-268 (2009)
Title The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing .
Author Miele,A., Medina,R., van Wijnen,A.J., Stein,G.S. and Stein,J.L.
Journal J. Cell. Biochem. 102 (1), 136-148 (2007)
Title Human chromosome 11 DNA sequence and analysis including novel gene identification .
Author Taylor,T.D., Noguchi,H., Totoki,Y., Toyoda,A., Kuroki,Y., Dewar,K., Lloyd,C., Itoh,T., Takeda,T., Kim,D.W., She,X., Barlow,K.F., Bloom,T., Bruford,E., Chang,J.L., Cuomo,C.A., Eichler,E., FitzGerald,M.G., Jaffe,D.B., LaButti,K., Nicol,R., Park,H.S., Seaman,C., Sougnez,C., Yang,X., Zimmer,A.R., Zody,M.C., Birren,B.W., Nusbaum,C., Fujiyama,A., Hattori,M., Rogers,J., Lander,E.S. and Sakaki,Y.
Journal Nature 440 (7083), 497-500 (2006)
Title Transcriptome analysis of human gastric cancer .
Author Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title The tripartite motif family identifies cell compartments .
Author Reymond,A., Meroni,G., Fantozzi,A., Merla,G., Cairo,S., Luzi,L., Riganelli,D., Zanaria,E., Messali,S., Cainarca,S., Guffanti,A., Minucci,S., Pelicci,P.G. and Ballabio,A.
Journal EMBO J. 20 (9), 2140-2151 (2001)
Title Isolation of a mouse brain cDNA expressed in developing neuroblasts and mature neurons .
Author Boutou,E., Matsas,R. and Mamalaki,A.
Journal Brain Res. Mol. Brain Res. 86 (1-2), 153-167 (2001)
Title A 7.5 Mb sequence-ready PAC contig and gene expression map of human chromosome 11p13-p14.1 .
Author Gawin,B., Niederfuhr,A., Schumacher,N., Hummerich,H., Little,P.F. and Gessler,M.
Journal Genome Res. 9 (11), 1074-1086 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878