• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tripartite motif containing 44 (TRIM44), mRNA.


RefSeq Accession Definition Services Price Order
NM_017583 Homo sapiens tripartite motif containing 44 (TRIM44), mRNA. ORF Sequence $300.15
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_017583.4, 205277436
Length 4337 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tripartite motif containing 44 (TRIM44), mRNA.
Product tripartite motif-containing protein 44
Comment

Summary: This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC013166.1, BC024031.2 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_060053.2
CDS 308..1342
Misc Feature(1)836..952
Misc Feature(2)836..952
Misc Feature(3)order(842..844,851..853,908..910,926..928)
Exon (1)1..976
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (2)977..1054
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (3)1055..1294
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (4)1295..1314
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Exon (5)1315..4337
Gene:TRIM44
Gene Synonym:DIPB; HSA249128; MC7
Translation MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEY VHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDE SDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCP DHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVER LKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
79+dbSNP:
79+a, gdbSNP:35980563
105+g, tdbSNP:34549335
140+c, gdbSNP:149734513
279+c, gdbSNP:112136832
282+a, gdbSNP:12804197
284+c, gdbSNP:12803873
286+c, tdbSNP:201360919
355+c, gdbSNP:141513598
370+c, tdbSNP:146195111
376+a, cdbSNP:201198741
418+c, tdbSNP:139199019
481+a, gdbSNP:34392570
579+c, tdbSNP:143958152
634+a, gdbSNP:148551696
660+a, gdbSNP:142324712
849+a, gdbSNP:202091709
859+c, tdbSNP:146343301
886+c, tdbSNP:139171417
895+c, tdbSNP:199988558
918+c, tdbSNP:142660136
923+g, tdbSNP:201122755
1008+dbSNP:
1008+c, tdbSNP:144607373
1062+dbSNP:
1062+g, tdbSNP:149318521
1148+g, tdbSNP:181145347
1222+a, gdbSNP:150664095
1234+c, gdbSNP:185989513
1248+a, gdbSNP:61758104
1268+a, cdbSNP:150418046
1298+dbSNP:
1298+a, gdbSNP:181043254
1299+a, tdbSNP:138227319
1341+dbSNP:
1341+a, gdbSNP:200834184
1365+a, g, tdbSNP:61881297
1654+a, gdbSNP:146748492
1680+a, gdbSNP:112757510
1689+a, gdbSNP:187376505
1754+a, gdbSNP:190760306
1862+c, tdbSNP:182988466
1934+a, gdbSNP:111289311
1996+a, gdbSNP:187239871
2064+a, gdbSNP:140579576
2215+c, tdbSNP:190141144
2410+c, gdbSNP:597254
2510+c, gdbSNP:150302930
2650+c, tdbSNP:137870591
2714+a, gdbSNP:12809
2729+g, tdbSNP:182857721
2778+c, tdbSNP:142335805
2885+c, tdbSNP:6709
2938+a, gdbSNP:187453708
2955+c, tdbSNP:145978710
2990+a, gdbSNP:192678756
3164..3165+, adbSNP:71457390
3165..3166+, aaaaa, aaaaaadbSNP:10636954
3182..3183+, aaaaa, aaaaaa, aaaaaaaadbSNP:56255775
3205+a, gdbSNP:185728796
3231+a, gdbSNP:188966081
3369+g, tdbSNP:202110872
3407+a, tdbSNP:61188486
3414+g, tdbSNP:138590624
3450+a, gdbSNP:2956335
3482+a, gdbSNP:141792110
3661+a, gdbSNP:192232885
3744+a, gdbSNP:74744989
3885+c, gdbSNP:184216022
3982+c, tdbSNP:144527625
4028+c, tdbSNP:148486848
4042+c, gdbSNP:188626075
4053+g, tdbSNP:200851723
4094+a, tdbSNP:11538402
4098+a, gdbSNP:111908180
4145+a, gdbSNP:16927957
4156+a, cdbSNP:141767985
4158+c, tdbSNP:181059511
4280+a, gdbSNP:150584314
Gene SymbolTRIM44
Gene SynonymDIPB; HSA249128; MC7
Chromosome11
Locus Map11p13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_017583 Homo sapiens tripartite motif containing 44 (TRIM44), mRNA. Full Length $1517.95
ORF Sequence $300.15
Title Overexpression of TRIM44 contributes to malignant outcome in gastric carcinoma .
Author Kashimoto,K., Komatsu,S., Ichikawa,D., Arita,T., Konishi,H., Nagata,H., Takeshita,H., Nishimura,Y., Hirajima,S., Kawaguchi,T., Shiozaki,A., Fujiwara,H., Okamoto,K., Tsuda,H. and Otsuji,E.
Journal Cancer Sci. 103 (11), 2021-2026 (2012)
Title Genomewide association study of movement-related adverse antipsychotic effects .
Author Aberg,K., Adkins,D.E., Bukszar,J., Webb,B.T., Caroff,S.N., Miller,D.D., Sebat,J., Stroup,S., Fanous,A.H., Vladimirov,V.I., McClay,J.L., Lieberman,J.A., Sullivan,P.F. and van den Oord,E.J.
Journal Biol. Psychiatry 67 (3), 279-282 (2010)
Title TRIM44 interacts with and stabilizes terf, a TRIM ubiquitin E3 ligase .
Author Urano,T., Usui,T., Takeda,S., Ikeda,K., Okada,A., Ishida,Y., Iwayanagi,T., Otomo,J., Ouchi,Y. and Inoue,S.
Journal Biochem. Biophys. Res. Commun. 383 (2), 263-268 (2009)
Title The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing .
Author Miele,A., Medina,R., van Wijnen,A.J., Stein,G.S. and Stein,J.L.
Journal J. Cell. Biochem. 102 (1), 136-148 (2007)
Title Human chromosome 11 DNA sequence and analysis including novel gene identification .
Author Taylor,T.D., Noguchi,H., Totoki,Y., Toyoda,A., Kuroki,Y., Dewar,K., Lloyd,C., Itoh,T., Takeda,T., Kim,D.W., She,X., Barlow,K.F., Bloom,T., Bruford,E., Chang,J.L., Cuomo,C.A., Eichler,E., FitzGerald,M.G., Jaffe,D.B., LaButti,K., Nicol,R., Park,H.S., Seaman,C., Sougnez,C., Yang,X., Zimmer,A.R., Zody,M.C., Birren,B.W., Nusbaum,C., Fujiyama,A., Hattori,M., Rogers,J., Lander,E.S. and Sakaki,Y.
Journal Nature 440 (7083), 497-500 (2006)
Title Transcriptome analysis of human gastric cancer .
Author Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title The tripartite motif family identifies cell compartments .
Author Reymond,A., Meroni,G., Fantozzi,A., Merla,G., Cairo,S., Luzi,L., Riganelli,D., Zanaria,E., Messali,S., Cainarca,S., Guffanti,A., Minucci,S., Pelicci,P.G. and Ballabio,A.
Journal EMBO J. 20 (9), 2140-2151 (2001)
Title Isolation of a mouse brain cDNA expressed in developing neuroblasts and mature neurons .
Author Boutou,E., Matsas,R. and Mamalaki,A.
Journal Brain Res. Mol. Brain Res. 86 (1-2), 153-167 (2001)
Title A 7.5 Mb sequence-ready PAC contig and gene expression map of human chromosome 11p13-p14.1 .
Author Gawin,B., Niederfuhr,A., Schumacher,N., Hummerich,H., Little,P.F. and Gessler,M.
Journal Genome Res. 9 (11), 1074-1086 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878