• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens notch 1 (NOTCH1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_017617 Homo sapiens notch 1 (NOTCH1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_017617.3, 148833507
Length 9309 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens notch 1 (NOTCH1), mRNA.
Product neurogenic locus notch homolog protein 1 preproprotein
Comment

Summary: This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development. [provided by RefSeq, Jul 2008].

RefSeq NP_060087.3
CDS 1..7668
Misc Feature(1)424..525
Misc Feature(2)order(427..429,469..471)
Misc Feature(3)532..648
Misc Feature(4)order(532..534,541..543,589..591)
Misc Feature(5)769..879
Misc Feature(6)order(769..771,778..780,820..822)
Misc Feature(7)883..996
Misc Feature(8)order(883..885,892..894,940..942)
Misc Feature(9)1003..1110
Misc Feature(10)order(1003..1005,1012..1014,1054..1056)
Misc Feature(11)1234..1350
Misc Feature(12)order(1234..1236,1243..1245,1291..1293)
Misc Feature(13)1354..1464
Misc Feature(14)order(1354..1356,1363..1365,1405..1407)
Misc Feature(15)1468..1578
Misc Feature(16)order(1468..1470,1477..1479,1519..1521)
Misc Feature(17)1582..1692
Misc Feature(18)order(1582..1584,1591..1593,1633..1635)
Misc Feature(19)1696..1803
Misc Feature(20)order(1696..1698,1705..1707,1744..1746)
Misc Feature(21)1807..1917
Misc Feature(22)order(1807..1809,1816..1818,1858..1860)
Misc Feature(23)2032..2139
Misc Feature(24)order(2032..2034,2041..2043,2083..2085)
Misc Feature(25)2146..2253
Misc Feature(26)order(2146..2148,2155..2157,2194..2196)
Misc Feature(27)2263..2367
Misc Feature(28)order(2266..2268,2308..2310)
Misc Feature(29)2371..2481
Misc Feature(30)order(2371..2373,2380..2382,2422..2424)
Misc Feature(31)2605..2715
Misc Feature(32)order(2605..2607,2614..2616,2656..2658)
Misc Feature(33)2719..2829
Misc Feature(34)order(2719..2721,2728..2730,2770..2772)
Misc Feature(35)2833..2943
Misc Feature(36)order(2833..2835,2842..2844,2884..2886)
Misc Feature(37)2962..3057
Misc Feature(38)3061..3171
Misc Feature(39)order(3061..3063,3070..3072,3112..3114)
Misc Feature(40)3436..3540
Misc Feature(41)order(3442..3444,3484..3486)
Misc Feature(42)3547..3657
Misc Feature(43)order(3547..3549,3556..3558,3598..3600)
Misc Feature(44)3685..3795
Misc Feature(45)order(3691..3693,3736..3738)
Misc Feature(46)3799..3915
Misc Feature(47)order(3799..3801,3808..3810,3856..3858)
Misc Feature(48)4324..4437
Misc Feature(49)4345..4467
Misc Feature(50)4453..4566
Misc Feature(51)4468..4593
Misc Feature(52)4594..4713
Misc Feature(53)4594..4683
Misc Feature(54)4696..4863
Misc Feature(55)4990..4995
Misc Feature(56)5008..5193
Misc Feature(57)5206..5268
Misc Feature(58)<5620..5874
Misc Feature(59)5764..6102
Misc Feature(60)5779..5868
Misc Feature(61)5794..6075
Misc Feature(62)5839..5865
Misc Feature(63)5863..5865
Misc Feature(64)5878..5970
Misc Feature(65)5965..6339
Misc Feature(66)5980..6069
Misc Feature(67)5995..6273
Misc Feature(68)6040..6066
Misc Feature(69)6079..6168
Misc Feature(70)6178..6267
Misc Feature(71)7438..7623
Exon (1)62..140
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (2)141..403
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (3)404..742
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (4)743..865
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (5)866..1099
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (6)1100..1255
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (7)1256..1441
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (8)1442..1555
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (9)1556..1669
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (10)1670..1903
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (11)1904..2014
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (12)2015..2207
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (13)2208..2353
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (14)2354..2467
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (15)2468..2587
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (16)2588..2740
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (17)2741..2969
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (18)2970..3171
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (19)3172..3325
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (20)3326..3510
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (21)3511..3643
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (22)3644..3901
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (23)3902..4014
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (24)4015..4586
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (25)4587..5018
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (26)5019..5167
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (27)5168..5384
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (28)5385..5472
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (29)5473..5638
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (30)5639..5934
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (31)5935..6082
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (32)6083..6180
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Exon (33)6181..9295
Gene:NOTCH1
Gene Synonym:hN1; TAN1
Translation MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP NPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLL TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN ECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNEC NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS YCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI PPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD CAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYY GREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVA AAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAP TPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN VDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVAS GTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPA NIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQE SPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(11)-dbSNP:
complement(11)-t, cdbSNP:148223844
complement(64)-dbSNP:
complement(64)-g, adbSNP:114832250
complement(263)-dbSNP:
complement(263)-t, cdbSNP:191357265
complement(311)-t, cdbSNP:199654211
complement(312)-g, adbSNP:4489420
complement(368)-g, adbSNP:187473846
complement(390)-t, cdbSNP:61751559
complement(465)-dbSNP:
complement(465)-g, adbSNP:61751558
complement(565)-, adbSNP:140371192
complement(582..583)-, ggdbSNP:146350322
complement(608)-t, cdbSNP:182763411
complement(663)-t, cdbSNP:11574872
complement(668)-c, adbSNP:35083144
complement(701)-t, cdbSNP:150737112
complement(711)-g, adbSNP:61751557
complement(723)-t, cdbSNP:11574873
complement(825)-dbSNP:
complement(825)-g, adbSNP:61751556
complement(852)-g, c, adbSNP:2229975
complement(873)-dbSNP:
complement(873)-g, adbSNP:143654474
complement(899)-g, adbSNP:11574885
complement(931)-t, gdbSNP:202145498
complement(963)-g, adbSNP:201158068
complement(1023)-g, adbSNP:200324222
complement(1042)-g, cdbSNP:201236538
complement(1045)-t, gdbSNP:200520088
complement(1077)-g, adbSNP:202235419
complement(1122)-dbSNP:
complement(1122)-g, adbSNP:192683347
complement(1295)-dbSNP:
complement(1295)-g, adbSNP:200562991
complement(1297)-g, adbSNP:188014209
complement(1389)-g, adbSNP:61733293
complement(1440)-g, adbSNP:61751555
complement(1511)-dbSNP:
complement(1511)-t, cdbSNP:201768800
complement(1554)-t, cdbSNP:190721271
complement(1635)-dbSNP:
complement(1635)-t, cdbSNP:11574889
complement(1665)-t, cdbSNP:148331061
complement(1787)-dbSNP:
complement(1787)-g, adbSNP:61755997
complement(1862)-t, cdbSNP:138504021
complement(1867..1868)-, tdbSNP:35911527
complement(1950)-dbSNP:
complement(1950)-g, adbSNP:147086700
complement(1962)-g, adbSNP:61751554
complement(1981)-t, cdbSNP:201077220
complement(2049)-dbSNP:
complement(2049)-t, cdbSNP:61751553
complement(2080)-t, cdbSNP:79782048
complement(2085)-g, adbSNP:200573958
complement(2101)-t, gdbSNP:201855457
complement(2134)-t, gdbSNP:200692749
complement(2135)-g, adbSNP:61755998
complement(2191)-g, adbSNP:199666126
complement(2205)-t, cdbSNP:2229970
complement(2206)-t, cdbSNP:201662530
complement(2218)-dbSNP:
complement(2218)-t, cdbSNP:200816814
complement(2226)-g, adbSNP:201889382
complement(2265)-t, cdbSNP:2229971
complement(2295)-g, adbSNP:144066379
complement(2349)-g, adbSNP:200092299
complement(2355)-dbSNP:
complement(2355)-g, adbSNP:199719103
complement(2359)-t, cdbSNP:199672693
complement(2379)-g, adbSNP:200565505
complement(2433)-g, adbSNP:61751552
complement(2434)-t, cdbSNP:201620755
complement(2436..2437)-, cdbSNP:35768530
complement(2452)-g, cdbSNP:199841979
complement(2496)-dbSNP:
complement(2496)-c, adbSNP:61751551
complement(2501)-g, adbSNP:202144877
complement(2505)-t, gdbSNP:111756273
complement(2511)-g, c, adbSNP:201521828
complement(2542)-t, cdbSNP:35136134
complement(2576)-g, adbSNP:199505287
complement(2604)-dbSNP:
complement(2604)-g, adbSNP:115235667
complement(2611)-t, cdbSNP:200235006
complement(2646)-t, adbSNP:61751550
complement(2661)-g, adbSNP:61751549
complement(2664)-g, adbSNP:61751548
complement(2675)-g, cdbSNP:199506721
complement(2691)-t, cdbSNP:11574895
complement(2718)-g, adbSNP:200243788
complement(2724)-g, adbSNP:61751547
complement(2734)-g, adbSNP:201620358
complement(2769)-dbSNP:
complement(2769)-t, cdbSNP:201985795
complement(2784)-t, cdbSNP:200082362
complement(2805)-g, adbSNP:200332386
complement(2813)-t, cdbSNP:35962301
complement(2820)-t, adbSNP:199912866
complement(2908)-t, cdbSNP:201053795
complement(2917)-t, cdbSNP:200699541
complement(3011)-dbSNP:
complement(3011)-g, adbSNP:201163739
complement(3115)-t, cdbSNP:200207651
complement(3198)-dbSNP:
complement(3198)-t, cdbSNP:199892488
complement(3249)-g, adbSNP:139994842
complement(3294)-g, adbSNP:61751546
complement(3315)-c, adbSNP:3812602
complement(3319)-t, cdbSNP:41309764
complement(3333)-dbSNP:
complement(3333)-g, adbSNP:61751545
complement(3374)-g, adbSNP:200871631
complement(3384)-t, cdbSNP:200608278
complement(3405)-t, cdbSNP:192914380
complement(3468)-g, adbSNP:199793164
complement(3528)-dbSNP:
complement(3528)-g, adbSNP:202133782
complement(3579)-c, adbSNP:61751544
complement(3597)-g, adbSNP:150666307
complement(3664)-dbSNP:
complement(3664)-t, cdbSNP:112900950
complement(3767)-g, adbSNP:80340744
complement(3770)-g, adbSNP:200245794
complement(3780)-g, cdbSNP:201354526
complement(3835)-g, adbSNP:182330532
complement(3836)-t, cdbSNP:61751543
complement(3900)-g, adbSNP:201791826
complement(3970)-dbSNP:
complement(3970)-t, cdbSNP:149057410
complement(3984)-g, adbSNP:201556407
complement(4028)-dbSNP:
complement(4028)-g, adbSNP:183156491
complement(4031)-g, adbSNP:201215245
complement(4049)-c, adbSNP:150343794
complement(4056)-g, adbSNP:200099319
complement(4095)-g, adbSNP:202023240
complement(4129)-g, adbSNP:61751542
complement(4168)-t, gdbSNP:191645600
complement(4179)-g, adbSNP:200664704
complement(4262)-g, adbSNP:76473337
complement(4290)-g, adbSNP:78857347
complement(4313)-t, cdbSNP:61751541
complement(4315)-t, cdbSNP:200232299
complement(4332)-t, cdbSNP:59035110
complement(4348)-t, cdbSNP:147841035
complement(4372)-t, cdbSNP:200495793
complement(4407)-g, adbSNP:202231073
complement(4512)-, cdbSNP:41309766
complement(4536)-g, adbSNP:61751540
complement(4548)-g, adbSNP:199740882
complement(4626)-dbSNP:
complement(4626)-g, adbSNP:142375989
complement(4698)-g, adbSNP:200462746
complement(4709)-g, cdbSNP:199860726
complement(4757)-t, cdbSNP:201360886
complement(4823)-t, cdbSNP:76371972
complement(4827)-g, adbSNP:113634293
complement(4867)-t, cdbSNP:187112709
complement(4887)-g, adbSNP:61751539
complement(5011)-g, adbSNP:2229968
complement(5073)-dbSNP:
complement(5073)-t, cdbSNP:61751538
complement(5094)-g, adbSNP:10521
complement(5115)-t, cdbSNP:201797774
complement(5124)-c, adbSNP:35980907
complement(5138)-t, cdbSNP:200053816
complement(5175)-dbSNP:
complement(5175)-g, adbSNP:61751536
complement(5226)-g, adbSNP:116316039
complement(5340)-t, cdbSNP:148187717
complement(5403)-dbSNP:
complement(5403)-t, cdbSNP:201358664
complement(5414)-g, adbSNP:201779159
complement(5416)-t, cdbSNP:114479009
complement(5427)-g, adbSNP:184874260
complement(5440)-t, cdbSNP:201968456
complement(5445)-g, adbSNP:61751535
complement(5500)-dbSNP:
complement(5500)-g, adbSNP:73668312
complement(5506)-t, cdbSNP:200100726
complement(5542)-t, gdbSNP:35652719
complement(5605)-c, adbSNP:200603539
complement(5631)-g, adbSNP:35627681
complement(5673)-dbSNP:
complement(5673)-t, cdbSNP:2229972
complement(5679)-t, cdbSNP:2229973
complement(5698)-t, cdbSNP:200190466
complement(5733)-g, adbSNP:61751534
complement(5776)-g, adbSNP:199652954
complement(5870)-t, gdbSNP:201174576
complement(5967)-dbSNP:
complement(5967)-g, adbSNP:73668311
complement(5988)-t, cdbSNP:186453356
complement(6054)-g, adbSNP:202198360
complement(6055)-c, adbSNP:3812597
complement(6105)-dbSNP:
complement(6105)-g, adbSNP:188357478
complement(6120)-g, adbSNP:201625763
complement(6257)-dbSNP:
complement(6257)-t, cdbSNP:201058656
complement(6291)-t, cdbSNP:201987555
complement(6363)-g, adbSNP:61751533
complement(6397)-g, adbSNP:61733294
complement(6454)-g, cdbSNP:116317506
complement(6481)-g, adbSNP:201518848
complement(6488)-c, adbSNP:35900692
complement(6498)-t, cdbSNP:201289055
complement(6509)-t, cdbSNP:200254239
complement(6516)-c, adbSNP:199673148
complement(6555)-t, cdbSNP:2229974
complement(6570)-g, cdbSNP:200630233
complement(6582)-g, adbSNP:200853719
complement(6648)-t, cdbSNP:3812596
complement(6666)-t, cdbSNP:202229687
complement(6681)-g, cdbSNP:61755042
complement(6685)-t, cdbSNP:202096917
complement(6714)-g, adbSNP:201499253
complement(6727)-t, cdbSNP:61751491
complement(6733)-t, cdbSNP:201613894
complement(6777)-g, adbSNP:61751490
complement(6788)-t, cdbSNP:200521815
complement(6836)-g, adbSNP:200370953
complement(6853)-t, cdbSNP:61751489
complement(6870)-g, adbSNP:61751488
complement(6897)-g, adbSNP:201643432
complement(6941)-g, adbSNP:200929799
complement(6975)-g, adbSNP:200814776
complement(6980)-t, cdbSNP:202065858
complement(6991)-t, cdbSNP:111309246
complement(7071)-g, adbSNP:61751487
complement(7083)-t, cdbSNP:147041036
complement(7090)-t, cdbSNP:201045092
complement(7171)-g, cdbSNP:192619687
complement(7209)-t, cdbSNP:61751486
complement(7230)-c, adbSNP:199839390
complement(7233)-g, adbSNP:11574911
complement(7289)-g, cdbSNP:36049318
complement(7298)-g, adbSNP:201493851
complement(7304)-t, cdbSNP:146855201
complement(7313)-g, adbSNP:199777870
complement(7338)-t, cdbSNP:35320927
complement(7369)-g, c, adbSNP:61755043
complement(7371)-t, cdbSNP:61751484
complement(7515)-c, adbSNP:34152221
complement(7536)-t, cdbSNP:192299793
complement(7606)-t, cdbSNP:111627256
complement(7645)-g, adbSNP:200893930
complement(7648)-t, cdbSNP:188270459
complement(7657)-c, adbSNP:182522714
complement(7667)-t, cdbSNP:190691338
complement(7674)-t, cdbSNP:73668310
complement(7794)-t, cdbSNP:3124591
complement(7804)-g, adbSNP:11574912
complement(7812)-, adbSNP:150688870
complement(7982)-g, adbSNP:11574913
complement(8078)-g, adbSNP:187411222
complement(8120..8121)-, gdbSNP:71492124
complement(8234..8235)-, gdbSNP:35791199
complement(8238)-t, cdbSNP:111453320
complement(8329)-g, adbSNP:112497358
complement(8422)-g, cdbSNP:148391832
complement(8430)-t, cdbSNP:147349918
complement(8460..8461)-, gdbSNP:141166049
complement(8483)-, tdbSNP:67936356
complement(8560..8561)-, gdbSNP:148193047
complement(8607)-g, adbSNP:114534583
complement(8618)-g, adbSNP:182946628
complement(8637)-g, cdbSNP:116716394
complement(8694)-g, adbSNP:111544054
complement(8708)-t, cdbSNP:113888617
complement(8759)-t, cdbSNP:3124998
complement(8813)-t, cdbSNP:113845544
complement(8824)-t, cdbSNP:187180441
complement(8834)-t, cdbSNP:76088346
complement(9007)-g, adbSNP:6563
complement(9048)-g, adbSNP:59626418
complement(9079)-t, cdbSNP:34162191
complement(9092)-g, adbSNP:180920763
complement(9109)-g, adbSNP:111363175
complement(9143)-t, cdbSNP:138713877
complement(9152)-t, adbSNP:73668309
Gene SymbolNOTCH1
Gene SynonymhN1; TAN1
Chromosome9
Locus Map9q34.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_017617 Homo sapiens notch 1 (NOTCH1), mRNA. On-demand TBD TBD
Title Non-degradative ubiquitination of the Notch1 receptor by the E3 ligase MDM2 activates the Notch signalling pathway .
Author Pettersson,S., Sczaniecka,M., McLaren,L., Russell,F., Gladstone,K., Hupp,T. and Wallace,M.
Journal Biochem. J. 450 (3), 523-536 (2013)
Title Cross-talk between leukemic and endothelial cells promotes angiogenesis by VEGF activation of the Notch/Dll4 pathway .
Author Zhang,J., Ye,J., Ma,D., Liu,N., Wu,H., Yu,S., Sun,X., Tse,W. and Ji,C.
Journal Carcinogenesis 34 (3), 667-677 (2013)
Title Integrated mutational and cytogenetic analysis identifies new prognostic subgroups in chronic lymphocytic leukemia .
Author Rossi,D., Rasi,S., Spina,V., Bruscaggin,A., Monti,S., Ciardullo,C., Deambrogi,C., Khiabanian,H., Serra,R., Bertoni,F., Forconi,F., Laurenti,L., Marasca,R., Dal-Bo,M., Rossi,F.M., Bulian,P., Nomdedeu,J., Del Poeta,G., Gattei,V., Pasqualucci,L., Rabadan,R., Foa,R., Dalla-Favera,R. and Gaidano,G.
Journal Blood 121 (8), 1403-1412 (2013)
Title Associations between high levels of Notch1 expression and high invasion and poor overall survival in hepatocellular carcinoma .
Author Zhou,L., Zhang,N., Li,Q.J., Sun,W., Zhang,Y., Wang,D.S. and Dou,K.F.
Journal Tumour Biol. 34 (1), 543-553 (2013)
Title Notch1 is required for hypoxia-induced proliferation, invasion and chemoresistance of T-cell acute lymphoblastic leukemia cells .
Author Zou,J., Li,P., Lu,F., Liu,N., Dai,J., Ye,J., Qu,X., Sun,X., Ma,D., Park,J. and Ji,C.
Journal J Hematol Oncol 6, 3 (2013)
Title T cell leukemia-associated human Notch/translocation-associated Notch homologue has I kappa B-like activity and physically interacts with nuclear factor-kappa B proteins in T cells .
Author Guan,E., Wang,J., Laborda,J., Norcross,M., Baeuerle,P.A. and Hoffman,T.
Journal J. Exp. Med. 183 (5), 2025-2032 (1996)
Title The human NOTCH1, 2, and 3 genes are located at chromosome positions 9q34, 1p13-p11, and 19p13.2-p13.1 in regions of neoplasia-associated translocation .
Author Larsson,C., Lardelli,M., White,I. and Lendahl,U.
Journal Genomics 24 (2), 253-258 (1994)
Title A human homologue of the Drosophila developmental gene, Notch, is expressed in CD34+ hematopoietic precursors .
Author Milner,L.A., Kopan,R., Martin,D.I. and Bernstein,I.D.
Journal Blood 83 (8), 2057-2062 (1994)
Title A homolog of Drosophila Notch expressed during mammalian development .
Author Weinmaster,G., Roberts,V.J. and Lemke,G.
Journal Development 113 (1), 199-205 (1991)
Title TAN-1, the human homolog of the Drosophila notch gene, is broken by chromosomal translocations in T lymphoblastic neoplasms .
Author Ellisen,L.W., Bird,J., West,D.C., Soreng,A.L., Reynolds,T.C., Smith,S.D. and Sklar,J.
Journal Cell 66 (4), 649-661 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.