• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu34521 Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu34521C Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_018178.5, 209954684
Length 858 bp
Structure linear
Update Date 02-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA.
Product Golgi phosphoprotein 3-like
Comment

Summary: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: AJ296153.1, BM928226.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_060648.2
CDS 218..1075
Misc Feature(1)197..199
Misc Feature(2)359..1051
Misc Feature(3)359..1051
Misc Feature(4)743..778
Exon (1)1..205
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (2)206..400
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (3)401..532
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (4)533..647
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (5)648..3171
Gene:GOLPH3L
Gene Synonym:GPP34R
Translation MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDK EGYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLD ETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNF LLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFS SLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLAAFNKS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(49)-dbSNP:
complement(49)-g, adbSNP:189511798
complement(60)-g, adbSNP:372333891
complement(188)-t, cdbSNP:186996853
complement(211)-dbSNP:
complement(211)-t, cdbSNP:374751790
complement(212)-t, cdbSNP:199762068
complement(216)-g, cdbSNP:145494612
complement(243)-c, adbSNP:138591221
complement(254)-t, cdbSNP:371196690
complement(263)-t, cdbSNP:202064653
complement(279)-g, adbSNP:200240175
complement(292)-t, cdbSNP:369900038
complement(333)-t, cdbSNP:187929207
complement(357)-g, adbSNP:140725896
complement(363)-g, adbSNP:200411858
complement(409)-dbSNP:
complement(409)-t, adbSNP:200454281
complement(427)-g, cdbSNP:142661978
complement(442)-t, cdbSNP:200166512
complement(457)-t, cdbSNP:374881765
complement(464)-g, adbSNP:140036674
complement(467)-c, adbSNP:372580751
complement(473)-g, adbSNP:149790730
complement(474)-t, cdbSNP:202150298
complement(480)-t, cdbSNP:150623963
complement(498)-g, adbSNP:371392300
complement(510)-t, cdbSNP:139457115
complement(634)-dbSNP:
complement(634)-t, cdbSNP:200566228
complement(676)-dbSNP:
complement(676)-t, cdbSNP:144256489
complement(684)-g, adbSNP:189937805
complement(707)-t, c, adbSNP:186291546
complement(716)-g, adbSNP:371755105
complement(720)-g, adbSNP:367645623
complement(724)-g, cdbSNP:138645525
complement(751)-c, adbSNP:369006080
complement(760)-g, cdbSNP:375693376
complement(831)-t, cdbSNP:371107154
complement(843)-t, adbSNP:377435219
complement(844)-t, cdbSNP:145448238
complement(865)-g, cdbSNP:139931222
complement(867)-t, cdbSNP:200254348
complement(943)-t, cdbSNP:376056196
complement(962)-c, adbSNP:150307845
complement(984)-t, cdbSNP:372801363
complement(1020)-t, cdbSNP:147746396
complement(1029)-t, gdbSNP:369066265
complement(1059)-g, adbSNP:147485965
complement(1065)-t, cdbSNP:151307247
complement(1070)-g, adbSNP:199899113
complement(1091)-g, adbSNP:368695370
complement(1110)-t, cdbSNP:191202555
complement(1217)-g, adbSNP:143175167
complement(1252)-c, adbSNP:371437566
complement(1257)-g, adbSNP:138904157
complement(1303)-g, cdbSNP:3087960
complement(1671)-g, adbSNP:78682168
complement(1766)-t, cdbSNP:369612605
1787+c, tdbSNP:142029366
complement(1901)-g, adbSNP:55938461
complement(1902)-g, adbSNP:58216214
complement(2012)-t, gdbSNP:75587166
complement(2223)-g, cdbSNP:147980386
2235+a, gdbSNP:145191213
complement(2270)-t, cdbSNP:1877469
complement(2363)-g, adbSNP:186962808
complement(2433)-c, adbSNP:181850438
complement(2520)-g, adbSNP:140239512
complement(2696)-t, adbSNP:11542551
complement(2697)-t, cdbSNP:111779351
complement(2800)-c, adbSNP:189793739
2880+a, gdbSNP:138562827
2911+a, cdbSNP:9733
3033+a, gdbSNP:3768008
3065+a, gdbSNP:3768009
Gene SymbolGOLPH3L
Gene SynonymGPP34R
Chromosome1
Locus Map1q21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018178 Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA. In-stock $99.00 5-7
XM_006711428 PREDICTED: Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), transcript variant X1, mRNA. On-demand $159.00 7-9
Title Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment .
Author Kirin M, Chandra A, Charteris DG, Hayward C, Campbell S, Celap I, Bencic G, Vatavuk Z, Kirac I, Richards AJ, Tenesa A, Snead MP, Fleck BW, Singh J, Harsum S, Maclaren RE, den Hollander AI, Dunlop MG, Hoyng CB, Wright AF, Campbell H, Vitart V and Mitry D.
Journal Hum. Mol. Genet. 22 (15), 3174-3185 (2013)
Title GOLPH3L antagonizes GOLPH3 to determine Golgi morphology .
Author Ng MM, Dippold HC, Buschman MD, Noakes CJ and Field SJ.
Journal Mol. Biol. Cell 24 (6), 796-808 (2013)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch P, Li N, Milstein S, Fan C, Hao T, Szabo G, Hu Z, Venkatesan K, Bethel G, Martin P, Rogers J, Lawlor S, McLaren S, Dricot A, Borick H, Cusick ME, Vandenhaute J, Dunham I, Hill DE and Vidal M.
Journal Genomics 89 (3), 307-315 (2007)
Title Proteomics characterization of abundant Golgi membrane proteins .
Author Bell AW, Ward MA, Blackstock WP, Freeman HN, Choudhary JS, Lewis AP, Chotai D, Fazel A, Gushue JN, Paiement J, Palcy S, Chevet E, Lafreniere-Roula M, Solari R, Thomas DY, Rowley A and Bergeron JJ.
Journal J. Biol. Chem. 276 (7), 5152-5165 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.