• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA.


RefSeq Accession Definition Services Price Order
NM_018178 Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA. ORF Sequence $248.82
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_018178.5, 209954684
Length 3208 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA.
Product Golgi phosphoprotein 3-like
Comment

Summary: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: AJ296153.1, BM928226.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_060648.2
CDS 218..1075
Misc Feature(1)197..199
Misc Feature(2)389..1051
Misc Feature(3)389..1051
Misc Feature(4)743..778
Exon (1)1..205
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (2)206..400
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (3)401..532
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (4)533..647
Gene:GOLPH3L
Gene Synonym:GPP34R
Exon (5)648..3171
Gene:GOLPH3L
Gene Synonym:GPP34R
Translation MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDK EGYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLD ETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNF LLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFS SLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLAAFNKS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(49)-dbSNP:
complement(49)-g, adbSNP:189511798
complement(188)-t, cdbSNP:186996853
complement(212)-dbSNP:
complement(212)-t, cdbSNP:199762068
complement(216)-g, cdbSNP:145494612
complement(243)-t, cdbSNP:138591221
complement(263)-t, cdbSNP:202064653
complement(279)-g, adbSNP:200240175
complement(333)-t, cdbSNP:187929207
complement(357)-g, adbSNP:140725896
complement(363)-g, adbSNP:200411858
complement(403)-dbSNP:
complement(403)-c, adbSNP:143435806
complement(409)-t, adbSNP:200454281
complement(427)-g, cdbSNP:142661978
complement(442)-t, cdbSNP:200166512
complement(464)-g, adbSNP:140036674
complement(473)-g, adbSNP:149790730
complement(474)-t, cdbSNP:202150298
complement(480)-t, cdbSNP:150623963
complement(510)-t, cdbSNP:139457115
complement(588)-dbSNP:
complement(588)-t, gdbSNP:141755100
complement(634)-t, cdbSNP:200566228
complement(676)-dbSNP:
complement(676)-t, cdbSNP:144256489
complement(684)-g, adbSNP:189937805
complement(707)-t, c, adbSNP:186291546
complement(724)-g, cdbSNP:138645525
complement(844)-t, cdbSNP:145448238
complement(865)-g, cdbSNP:139931222
complement(867)-t, cdbSNP:200254348
complement(962)-c, adbSNP:150307845
complement(1020)-t, cdbSNP:147746396
complement(1059)-g, adbSNP:147485965
complement(1065)-t, cdbSNP:151307247
complement(1070)-g, adbSNP:199899113
complement(1110)-t, cdbSNP:191202555
complement(1217)-g, adbSNP:143175167
complement(1257)-g, adbSNP:138904157
complement(1303)-g, cdbSNP:3087960
complement(1671)-g, adbSNP:78682168
complement(1787)-t, cdbSNP:142029366
complement(1901)-g, adbSNP:55938461
complement(1902)-g, adbSNP:58216214
complement(2012)-t, gdbSNP:75587166
complement(2223)-g, cdbSNP:147980386
complement(2235)-g, adbSNP:145191213
complement(2270)-t, cdbSNP:1877469
complement(2363)-g, adbSNP:186962808
complement(2433)-c, adbSNP:181850438
complement(2520)-g, adbSNP:140239512
complement(2696)-t, adbSNP:11542551
complement(2697)-t, cdbSNP:111779351
complement(2800)-c, adbSNP:189793739
complement(2880)-g, adbSNP:138562827
complement(2911)-c, adbSNP:9733
complement(3033)-g, adbSNP:3768008
complement(3065)-g, adbSNP:3768009
Gene SymbolGOLPH3L
Gene SynonymGPP34R
Chromosome1
Locus Map1q21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_018178 Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA. Full Length $1122.80
ORF Sequence $248.82
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M.
Journal Genomics 89 (3), 307-315 (2007)
Title Proteomics characterization of abundant Golgi membrane proteins .
Author Bell,A.W., Ward,M.A., Blackstock,W.P., Freeman,H.N., Choudhary,J.S., Lewis,A.P., Chotai,D., Fazel,A., Gushue,J.N., Paiement,J., Palcy,S., Chevet,E., Lafreniere-Roula,M., Solari,R., Thomas,D.Y., Rowley,A. and Bergeron,J.J.
Journal J. Biol. Chem. 276 (7), 5152-5165 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878