Sequence in raw or FASTA format:
Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA.
| RefSeq Version | NM_018178.5, 209954684 |
| Length | 3208 bp |
| Structure | linear |
| Update Date | 10-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens golgi phosphoprotein 3-like (GOLPH3L), mRNA. |
| Product | Golgi phosphoprotein 3-like |
| Comment | Summary: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq]. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_060648.2 |
| CDS | 218..1075 | Exon (1) | 1..205 | Exon (2) | 1..205 | Exon (3) | 206..400 | Exon (4) | 401..532 | Exon (5) | 533..647 | Exon (6) | 648..3171 |
| Translation | MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDK
EGYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLD
ETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNF
LLFDMTTHPVTNTTEKQRLVKKLQDSVLERWVNDPQRMDKRTLALLVLAHSSDVLENVFS
SLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLAAFNKS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(162) | - | t, g | dbSNP:74721397 |
| complement(1303) | - | g, c | dbSNP:3087960 |
| complement(1671) | - | g, a | dbSNP:78682168 |
| complement(1901) | - | g, a | dbSNP:55938461 |
| complement(1902) | - | g, a | dbSNP:58216214 |
| complement(2012) | - | t, g | dbSNP:75587166 |
| complement(2270) | - | t, c | dbSNP:1877469 |
| complement(2696) | - | t, a | dbSNP:11542551 |
| complement(2697) | - | t, c | dbSNP:111779351 |
| 2911 | + | a, c | dbSNP:9733 |
| 3033 | + | a, g | dbSNP:3768008 |
| 3065 | + | a, g | dbSNP:3768009 |
| Gene Symbol | GOLPH3L |
| Gene Synonym | FLJ10687; GPP34R |
| Chromosome | 1 |
| Locus Map | 1q21.3 |
| All Transcripts | NM_018178 |
| Title | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score . |
| Author | Rose,J.E., Behm,F.M., Drgon,T., Johnson,C. and Uhl,G.R. |
| Journal | Mol. Med. 16 (7-8), 247-253 (2010) |
| Title | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes . |
| Author | Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M. |
| Journal | Genomics 89 (3), 307-315 (2007) |
| Title | Proteomics characterization of abundant Golgi membrane proteins . |
| Author | Bell,A.W., Ward,M.A., Blackstock,W.P., Freeman,H.N., Choudhary,J.S., Lewis,A.P., Chotai,D., Fazel,A., Gushue,J.N., Paiement,J., Palcy,S., Chevet,E., Lafreniere-Roula,M., Solari,R., Thomas,D.Y., Rowley,A. and Bergeron,J.J. |
| Journal | J. Biol. Chem. 276 (7), 5152-5165 (2001) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |