• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ethanolamine kinase 2 (ETNK2), mRNA.


RefSeq Accession Definition Services Price Order
NM_018208 Homo sapiens ethanolamine kinase 2 (ETNK2), mRNA. ORF Sequence $336.69
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_018208.2, 186659524
Length 2648 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ethanolamine kinase 2 (ETNK2), mRNA.
Product ethanolamine kinase 2
Comment

Summary: The protein encoded by this gene is a member of choline/ethanolamine kinase family which catalyzes the first step of phosphatidylethanolamine (PtdEtn) biosynthesis via the cytidine diphosphate (CDP) ethanolamine pathway. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC010082.2, AB073608.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_060678.2
CDS 328..1488
Misc Feature(1)61..63
Misc Feature(2)61..63
Misc Feature(3)505..1461
Misc Feature(4)505..1461
Misc Feature(5)574..1251
Misc Feature(6)order(592..594,598..600,604..609,613..615,655..657,
Misc Feature(7)order(592..594,607..609,613..615,655..657,661..663,
Misc Feature(8)order(598..600,604..606,1072..1074,1078..1080,1087..1089,
Misc Feature(9)order(700..702,709..714,721..726,754..765,889..891)
Exon (1)1..585
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Exon (2)586..845
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Exon (3)846..968
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Exon (4)969..1111
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Exon (5)1112..1195
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Exon (6)1196..1341
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Exon (7)1342..1415
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Exon (8)1416..2610
Gene:ETNK2
Gene Synonym:EKI2; HMFT1716; RP11-74C13.2
Translation MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDP DDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTEL LVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMA KIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLE SPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYP ARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALIQNQYSTIDFD FLRYAVIRFNQYFKVKPQASALEMPK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(71)-t, cdbSNP:191312273
complement(151)-g, adbSNP:187440692
complement(246)-g, adbSNP:12738682
complement(294)-t, gdbSNP:12738530
complement(356)-c, adbSNP:3737655
complement(608)-dbSNP:
complement(608)-t, cdbSNP:149143962
complement(651)-g, adbSNP:200236107
complement(677)-t, cdbSNP:202185285
complement(698)-t, cdbSNP:201400955
complement(801)-g, adbSNP:200166795
complement(826)-g, adbSNP:141281450
complement(827)-t, cdbSNP:144504466
complement(885)-dbSNP:
complement(885)-g, adbSNP:139650333
complement(886)-t, cdbSNP:142496647
complement(891)-g, cdbSNP:1880534
complement(954)-g, adbSNP:143999368
complement(1007)-dbSNP:
complement(1007)-g, adbSNP:3737657
complement(1008)-t, cdbSNP:138409813
complement(1010..1011)-, tdbSNP:35235705
complement(1042)-t, gdbSNP:200858943
complement(1053)-c, adbSNP:116285702
complement(1116)-dbSNP:
complement(1116)-g, adbSNP:140913993
complement(1143)-g, adbSNP:200739096
complement(1203)-dbSNP:
complement(1203)-g, adbSNP:201036824
complement(1231)-g, adbSNP:201980742
complement(1232)-t, cdbSNP:200305922
complement(1236)-g, cdbSNP:140658518
complement(1257)-g, cdbSNP:61825753
complement(1282)-t, adbSNP:144439568
complement(1308)-t, cdbSNP:149960550
complement(1317)-g, adbSNP:146679279
complement(1399)-dbSNP:
complement(1399)-t, cdbSNP:148772808
complement(1419)-dbSNP:
complement(1419)-g, adbSNP:76205451
complement(1645)-t, cdbSNP:139047077
complement(1686)-g, adbSNP:151131812
complement(1760)-g, adbSNP:41313900
complement(1764)-g, adbSNP:139891629
complement(1782)-g, adbSNP:117726554
complement(1850)-t, cdbSNP:77936713
complement(1853)-t, gdbSNP:75876713
complement(1854)-t, adbSNP:79403699
complement(2008)-g, cdbSNP:181336042
complement(2092)-g, adbSNP:76718240
complement(2220)-t, cdbSNP:145968121
complement(2351)-g, adbSNP:114187399
complement(2527)-t, cdbSNP:116590745
Gene SymbolETNK2
Gene SynonymEKI2; HMFT1716; RP11-74C13.2
Chromosome1
Locus Map1q32.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_018208 Homo sapiens ethanolamine kinase 2 (ETNK2), mRNA. Full Length $767.92
ORF Sequence $336.69
Title Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study .
Author Moyer,A.M., Fridley,B.L., Jenkins,G.D., Batzler,A.J., Pelleymounter,L.L., Kalari,K.R., Ji,Y., Chai,Y., Nordgren,K.K. and Weinshilboum,R.M.
Journal Toxicol. Sci. 120 (1), 33-41 (2011)
Title Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study .
Author Ehret,G.B., O'Connor,A.A., Weder,A., Cooper,R.S. and Chakravarti,A.
Journal Eur. J. Hum. Genet. 17 (12), 1650-1657 (2009)
Title Male-female differences in the genetic regulation of t-PA and PAI-1 levels in a Ghanaian population .
Author Schoenhard,J.A., Asselbergs,F.W., Poku,K.A., Stocki,S.A., Gordon,S., Vaughan,D.E., Brown,N.J., Moore,J.H. and Williams,S.M.
Journal Hum. Genet. 124 (5), 479-488 (2008)
Title Placental thrombosis and spontaneous fetal death in mice deficient in ethanolamine kinase 2 .
Author Tian,Y., Jackson,P., Gunter,C., Wang,J., Rock,C.O. and Jackowski,S.
Journal J. Biol. Chem. 281 (38), 28438-28449 (2006)
Title Eki2 is upregulated specifically in the testis during mouse sex determination .
Author Hurley,T.M., McClive,P.J., Sarraj,M.A. and Sinclair,A.H.
Journal Gene Expr. Patterns 4 (2), 135-140 (2004)
Title Overexpression of a mammalian ethanolamine-specific kinase accelerates the CDP-ethanolamine pathway .
Author Lykidis,A., Wang,J., Karim,M.A. and Jackowski,S.
Journal J. Biol. Chem. 276 (3), 2174-2179 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878