• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 35 (GDP-fucose transporter), member C1 (SLC35C1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19102 Homo sapiens solute carrier family 35 (GDP-fucose transporter), member C1 (SLC35C1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19102C Homo sapiens solute carrier family 35 (GDP-fucose transporter), member C1 (SLC35C1), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_018389.4, 223671914
Length 1095 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 35 (GDP-fucose transporter), member C1 (SLC35C1), transcript variant 1, mRNA.
Product GDP-fucose transporter 1 isoform a
Comment

Summary: This gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (a).

RefSeq NP_060859.4
CDS 713..1807
Misc Feature(1)692..694
Misc Feature(2)812..880
Misc Feature(3)812..880
Misc Feature(4)854..1690
Misc Feature(5)929..1261
Misc Feature(6)938..1006
Misc Feature(7)1043..1102
Misc Feature(8)1130..1198
Misc Feature(9)1211..1267
Misc Feature(10)1295..1354
Misc Feature(11)1391..1459
Misc Feature(12)1502..1570
Exon (1)1..1247
Gene:SLC35C1
Gene Synonym:CDG2C; FUCT1
Exon (2)1248..3488
Gene:SLC35C1
Gene Synonym:CDG2C; FUCT1
Translation MNRAPLKRSRILHMALTGASDPSAEAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNK YLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPL SVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGG FWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACI LFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSG TAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPEEPSPKDSEKS AMGV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
60+dbSNP:
60+c, tdbSNP:150274138
81+a, gdbSNP:77254044
410+c, gdbSNP:12289963
540+c, tdbSNP:78455013
584+a, cdbSNP:181710036
609+a, gdbSNP:187368323
699+a, gdbSNP:186564976
complement(710)-t, cdbSNP:3808976
734+c, tdbSNP:376834333
782..787+, gcagagdbSNP:376096923
790+a, gdbSNP:112575013
803+g, tdbSNP:398124345
814+c, tdbSNP:370986278
815+c, tdbSNP:12291397
822+a, gdbSNP:374598664
851+c, tdbSNP:368455704
858+c, gdbSNP:11538193
864+c, tdbSNP:370977402
938+a, gdbSNP:200202916
966+c, tdbSNP:150215024
967+a, gdbSNP:374975158
1021+c, tdbSNP:189405956
1024+a, cdbSNP:75224835
1042+c, tdbSNP:374967002
1077+a, tdbSNP:199663457
1151+c, tdbSNP:28939087
1234+c, tdbSNP:141379070
1246+c, tdbSNP:149296455
1268+dbSNP:
1268+a, gdbSNP:193920915
1277+c, gdbSNP:377408925
1309+c, tdbSNP:376082724
1310+a, gdbSNP:146971634
1319+a, gdbSNP:368377475
1342+a, gdbSNP:200577486
1345+c, gdbSNP:372353822
1357+c, tdbSNP:200626011
1363+a, gdbSNP:138126275
1375+a, gdbSNP:111773874
complement(1380)-t, gdbSNP:188712245
1418+a, gdbSNP:200146272
1430+a, gdbSNP:7130656
1450+c, tdbSNP:369955835
1460+a, gdbSNP:148606857
1478+c, tdbSNP:374599500
1527+c, tdbSNP:200318351
1549+c, tdbSNP:371692301
1552+a, c, tdbSNP:368103927
1590+c, tdbSNP:372897536
1601+a, gdbSNP:112375833
1609+a, gdbSNP:141170131
1615+g, tdbSNP:150743224
1635+c, gdbSNP:28937886
1637+a, gdbSNP:139119538
1687+a, gdbSNP:377098836
1700+a, gdbSNP:370865105
1708+c, tdbSNP:144046143
1718+a, gdbSNP:370250048
1737+g, tdbSNP:377292146
1759+a, gdbSNP:113735964
1766+c, tdbSNP:145613857
1767+a, cdbSNP:200843978
1793+a, gdbSNP:371853940
1856+a, gdbSNP:1139266
1988+a, cdbSNP:4362111
1998+a, cdbSNP:140259547
2125+c, tdbSNP:145216107
2145+c, tdbSNP:186869966
2221+a, gdbSNP:1139267
2269+a, gdbSNP:137953810
2454+c, tdbSNP:372196593
2524+c, tdbSNP:114787245
2549+c, tdbSNP:115462540
2550+a, gdbSNP:116113868
2658+c, gdbSNP:190447495
2762+a, cdbSNP:76564550
2781+c, gdbSNP:182686187
2875+c, gdbSNP:11538194
2881+c, tdbSNP:4756026
2894+c, tdbSNP:142419368
2934+a, gdbSNP:187013469
2965+c, tdbSNP:4756027
2991+a, gdbSNP:112917705
3015+a, gdbSNP:115509471
3049+a, tdbSNP:12291045
3119+c, tdbSNP:7943306
3122+c, tdbSNP:55758172
3129+a, gdbSNP:148127105
3131+a, gdbSNP:191299403
3132+a, gdbSNP:182393230
complement(3211)-g, adbSNP:142012266
3375+c, tdbSNP:150704136
3376+c, gdbSNP:139986610
3385..3386+, cdbSNP:370540815
3387+c, tdbSNP:10838518
3389+c, gdbSNP:189120012
3443+a, gdbSNP:79173599
Gene SymbolSLC35C1
Gene SynonymCDG2C; FUCT1
Chromosome11
Locus Map11p11.2
Title Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error .
Author Cheng CY, Schache M, Ikram MK, Young TL, Guggenheim JA, Vitart V, MacGregor S, Verhoeven VJ, Barathi VA, Liao J, Hysi PG, Bailey-Wilson JE, St Pourcain B, Kemp JP, McMahon G, Timpson NJ, Evans DM, Montgomery GW, Mishra A, Wang YX, Wang JJ, Rochtchina E, Polasek O, Wright AF, Amin N, van Leeuwen EM, Wilson JF, Pennell CE, van Duijn CM, de Jong PT, Vingerling JR, Zhou X, Chen P, Li R, Tay WT, Zheng Y, Chew M, Burdon KP, Craig JE, Iyengar SK, Igo RP Jr, Lass JH Jr, Chew EY, Haller T, Mihailov E, Metspalu A, Wedenoja J, Simpson CL, Wojciechowski R, Hohn R, Mirshahi A, Zeller T, Pfeiffer N, Lackner KJ, Bettecken T, Meitinger T, Oexle K, Pirastu M, Portas L, Nag A, Williams KM, Yonova-Doing E, Klein R, Klein BE, Hosseini SM, Paterson AD, Makela KM, Lehtimaki T, Kahonen M, Raitakari O, Yoshimura N, Matsuda F, Chen LJ, Pang CP, Yip SP, Yap MK, Meguro A, Mizuki N, Inoko H, Foster PJ, Zhao JH, Vithana E, Tai ES, Fan Q, Xu L, Campbell H, Fleck B, Rudan I, Aung T, Hofman A, Uitterlinden AG, Bencic G, Khor CC, Forward H, Parssinen O, Mitchell P, Rivadeneira F, Hewitt AW, Williams C, Oostra BA, Teo YY, Hammond CJ, Stambolian D, Mackey DA, Klaver CC, Wong TY, Saw SM and Baird PN.
Journal Am. J. Hum. Genet. 93 (2), 264-277 (2013)
Title FX enzyme and GDP-L-Fuc transporter expression in colorectal cancer .
Author Villar-Portela S, Muinelo-Romay L, Cuevas E, Gil-Martin E and Fernandez-Briera A.
Journal Histopathology 63 (2), 174-186 (2013)
Title Identification of functional elements of the GDP-fucose transporter SLC35C1 using a novel Chinese hamster ovary mutant .
Author Zhang P, Haryadi R, Chan KF, Teo G, Goh J, Pereira NA, Feng H and Song Z.
Journal Glycobiology 22 (7), 897-911 (2012)
Title Hematologically important mutations: leukocyte adhesion deficiency (first update) .
Author van de Vijver E, Maddalena A, Sanal O, Holland SM, Uzel G, Madkaikar M, de Boer M, van Leeuwen K, Koker MY, Parvaneh N, Fischer A, Law SK, Klein N, Tezcan FI, Unal E, Patiroglu T, Belohradsky BH, Schwartz K, Somech R, Kuijpers TW and Roos D.
Journal Blood Cells Mol. Dis. 48 (1), 53-61 (2012)
Title Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women .
Author Fox CS, Liu Y, White CC, Feitosa M, Smith AV, Heard-Costa N, Lohman K, Johnson AD, Foster MC, Greenawalt DM, Griffin P, Ding J, Newman AB, Tylavsky F, Miljkovic I, Kritchevsky SB, Launer L, Garcia M, Eiriksdottir G, Carr JJ, Gudnason V, Harris TB, Cupples LA and Borecki IB.
Journal PLoS Genet. 8 (5), E1002695 (2012)
Title Leukocyte adhesion deficiency II patients with a dual defect of the GDP-fucose transporter .
Author Helmus Y, Denecke J, Yakubenia S, Robinson P, Luhn K, Watson DL, McGrogan PJ, Vestweber D, Marquardt T and Wild MK.
Journal Blood 107 (10), 3959-3966 (2006)
Title Insights into leukocyte adhesion deficiency type 2 from a novel mutation in the GDP-fucose transporter gene .
Author Hidalgo A, Ma S, Peired AJ, Weiss LA, Cunningham-Rundles C and Frenette PS.
Journal Blood 101 (5), 1705-1712 (2003)
Title Complementation cloning identifies CDG-IIc, a new type of congenital disorders of glycosylation, as a GDP-fucose transporter deficiency .
Author Lubke T, Marquardt T, Etzioni A, Hartmann E, von Figura K and Korner C.
Journal Nat. Genet. 28 (1), 73-76 (2001)
Title The gene defective in leukocyte adhesion deficiency II encodes a putative GDP-fucose transporter .
Author Luhn K, Wild MK, Eckhardt M, Gerardy-Schahn R and Vestweber D.
Journal Nat. Genet. 28 (1), 69-72 (2001)
Title Congenital Disorders of N-linked Glycosylation Pathway Overview .
Author Sparks,S.E. and Krasnewich,D.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.