• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens PDZ binding kinase (PBK), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_018492 Homo sapiens PDZ binding kinase (PBK), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_018492.2, 18490990
Length 1899 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens PDZ binding kinase (PBK), mRNA.
Product lymphokine-activated killer T-cell-originated protein kinase
Comment

Summary: This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq, Jul 2008].

RefSeq NP_060962.2
CDS 202..1170
Misc Feature(1)172..174
Misc Feature(2)202..204
Misc Feature(3)202..204
Misc Feature(4)226..228
Misc Feature(5)226..228
Misc Feature(6)226..228
Misc Feature(7)256..258
Misc Feature(8)271..273
Misc Feature(9)295..297
Misc Feature(10)295..297
Misc Feature(11)301..1149
Misc Feature(12)316..930
Misc Feature(13)order(316..318,337..339,385..387,391..393,493..495,
Misc Feature(14)order(316..318,565..567,571..573,700..702,706..708,
Misc Feature(15)order(316..318,337..339,385..387,391..393,493..495,
Misc Feature(16)370..372
Misc Feature(17)376..378
Misc Feature(18)376..378
Misc Feature(19)order(754..774,823..834)
Misc Feature(20)1159..1167
Exon (1)1..181
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Exon (2)182..259
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Exon (3)260..353
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Exon (4)354..496
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Exon (5)497..666
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Exon (6)667..796
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Exon (7)797..973
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Exon (8)974..1854
Gene:PBK
Gene Synonym:CT84; Nori-3; SPK; TOPK
Translation MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEM MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC TNEDPKDRPSAAHIVEALETDV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(96)-dbSNP:
complement(96)-g, cdbSNP:11539583
complement(102)-g, adbSNP:3735743
complement(103)-c, adbSNP:3735744
complement(147)-t, cdbSNP:17057972
complement(153)-c, adbSNP:200576056
complement(182)-dbSNP:
complement(182)-t, cdbSNP:202051224
complement(205)-t, cdbSNP:150991972
complement(220)-t, adbSNP:142678781
complement(269)-dbSNP:
complement(269)-g, adbSNP:114501644
complement(300)-g, adbSNP:11539582
complement(312)-t, cdbSNP:55973425
complement(333)-g, adbSNP:35230929
complement(340)-g, adbSNP:199663154
complement(373)-dbSNP:
complement(373)-g, adbSNP:200725164
complement(391)-t, cdbSNP:201032351
complement(433)-g, adbSNP:112129421
complement(461)-t, adbSNP:62001048
complement(521)-dbSNP:
complement(521)-g, adbSNP:3779620
complement(538)-g, adbSNP:142068654
complement(552)-c, adbSNP:1675236
complement(557)-c, adbSNP:185478648
complement(581)-g, adbSNP:201842147
complement(675)-dbSNP:
complement(675)-t, gdbSNP:201933253
complement(733)-t, cdbSNP:201290873
complement(768)-g, cdbSNP:138952065
complement(775)-t, gdbSNP:200662690
complement(810..811)-dbSNP:
complement(810..811)-, cdbSNP:35061575
complement(861)-g, cdbSNP:17057901
complement(922)-t, gdbSNP:36086402
complement(933)-g, adbSNP:2272691
complement(955)-t, cdbSNP:143824466
complement(971)-t, cdbSNP:116080983
complement(1010)-dbSNP:
complement(1010)-g, cdbSNP:141116063
complement(1023)-g, cdbSNP:2294092
complement(1146)-g, adbSNP:112670476
complement(1197)-t, gdbSNP:202048382
complement(1199)-g, adbSNP:1052873
complement(1273)-g, cdbSNP:1052874
complement(1343)-t, cdbSNP:182928344
complement(1347)-g, adbSNP:111683270
complement(1380)-c, adbSNP:6986820
complement(1483)-g, adbSNP:190773208
complement(1520)-t, adbSNP:115017161
complement(1523)-t, adbSNP:143110122
complement(1582)-g, adbSNP:112744328
complement(1684)-g, adbSNP:186276247
complement(1706..1707)-, agadbSNP:60576879
complement(1706)-t, adbSNP:79343602
complement(1707..1708)-, agadbSNP:72602653
complement(1708..1709)-, agadbSNP:35361928
complement(1709..1710)-, aagdbSNP:144531893
complement(1710..1711)-, aagdbSNP:149449393
complement(1783)-g, adbSNP:10092096
complement(1807)-t, cdbSNP:145754266
complement(1851..1853)-, tctdbSNP:57448874
complement(1853)-t, cdbSNP:201300164
Gene SymbolPBK
Gene SynonymCT84; Nori-3; SPK; TOPK
Chromosome8
Locus Map8p21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018492 Homo sapiens PDZ binding kinase (PBK), mRNA. On-demand $549.00 14
Title c-Myc and E2F1 drive PBK/TOPK expression in high-grade malignant lymphomas .
Author Hu,F., Gartenhaus,R.B., Zhao,X.F., Fang,H.B., Minkove,S., Poss,D.E. and Rapoport,A.P.
Journal Leuk. Res. 37 (4), 447-454 (2013)
Title Phosphorylation of IkappaBalpha at serine 32 by T-lymphokine-activated killer cell-originated protein kinase is essential for chemoresistance against doxorubicin in cervical cancer cells .
Author Park,J.H., Yoon,D.S., Choi,H.J., Hahm,D.H. and Oh,S.M.
Journal J. Biol. Chem. 288 (5), 3585-3593 (2013)
Title Overexpression of T-LAK cell-originated protein kinase predicts poor prognosis in patients with stage I lung adenocarcinoma .
Author Wei,D.C., Yeh,Y.C., Hung,J.J., Chou,T.Y., Wu,Y.C., Lu,P.J., Cheng,H.C., Hsu,Y.L., Kuo,Y.L., Chen,K.Y. and Lai,J.M.
Journal Cancer Sci. 103 (4), 731-738 (2012)
Title T-LAK cell-originated protein kinase (TOPK) phosphorylation of MKP1 protein prevents solar ultraviolet light-induced inflammation through inhibition of the p38 protein signaling pathway .
Author Li,S., Zhu,F., Zykova,T., Kim,M.O., Cho,Y.Y., Bode,A.M., Peng,C., Ma,W., Carper,A., Langfald,A. and Dong,Z.
Journal J. Biol. Chem. 286 (34), 29601-29609 (2011)
Title T-LAK cell-originated protein kinase (TOPK) phosphorylation of Prx1 at Ser-32 prevents UVB-induced apoptosis in RPMI7951 melanoma cells through the regulation of Prx1 peroxidase activity .
Author Zykova,T.A., Zhu,F., Vakorina,T.I., Zhang,J., Higgins,L.A., Urusova,D.V., Bode,A.M. and Dong,Z.
Journal J. Biol. Chem. 285 (38), 29138-29146 (2010)
Title Protein expression of PDZ-binding kinase is up-regulated in hematologic malignancies and strongly down-regulated during terminal differentiation of HL-60 leukemic cells .
Author Nandi,A., Tidwell,M., Karp,J. and Rapoport,A.P.
Journal Blood Cells Mol. Dis. 32 (1), 240-245 (2004)
Title PBK/TOPK is a novel mitotic kinase which is upregulated in Burkitt's lymphoma and other highly proliferative malignant cells .
Author Simons-Evelyn,M., Bailey-Dell,K., Toretsky,J.A., Ross,D.D., Fenton,R., Kalvakolanu,D. and Rapoport,A.P.
Journal Blood Cells Mol. Dis. 27 (5), 825-829 (2001)
Title PDZ-binding kinase participates in spermatogenesis .
Author Zhao,S., Dai,J., Zhao,W., Xia,F., Zhou,Z., Wang,W., Gu,S., Ying,K., Xie,Y. and Mao,Y.
Journal Int. J. Biochem. Cell Biol. 33 (6), 631-636 (2001)
Title Cloning and expression of a novel MAPKK-like protein kinase, lymphokine-activated killer T-cell-originated protein kinase, specifically expressed in the testis and activated lymphoid cells .
Author Abe,Y., Matsumoto,S., Kito,K. and Ueda,N.
Journal J. Biol. Chem. 275 (28), 21525-21531 (2000)
Title Characterization of PDZ-binding kinase, a mitotic kinase .
Author Gaudet,S., Branton,D. and Lue,R.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (10), 5167-5172 (2000)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.