• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens PDZ binding kinase (PBK), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu03043 Homo sapiens PDZ binding kinase (PBK), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu03043C Homo sapiens PDZ binding kinase (PBK), transcript variant 1, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_018492.3, 525507088
Length 969 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens PDZ binding kinase (PBK), transcript variant 1, mRNA.
Product lymphokine-activated killer T-cell-originated protein kinase isoform 1
Comment

Summary: This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].


Transcript Variant: This variant (1) represents the longer transcript, and encodes the shorter isoform (1).

RefSeq NP_060962.2
CDS 465..1433
Misc Feature(1)279
Misc Feature(2)435..437
Misc Feature(3)465..467
Misc Feature(4)465..467
Misc Feature(5)489..491
Misc Feature(6)489..491
Misc Feature(7)489..491
Misc Feature(8)519..521
Misc Feature(9)534..536
Misc Feature(10)558..560
Misc Feature(11)558..560
Misc Feature(12)564..1412
Misc Feature(13)579..1193
Misc Feature(14)order(579..581,600..602,648..650,654..656,756..758,
Misc Feature(15)order(579..581,828..830,834..836,963..965,969..971,
Misc Feature(16)order(579..581,600..602,648..650,654..656,756..758,
Misc Feature(17)633..635
Misc Feature(18)639..641
Misc Feature(19)639..641
Misc Feature(20)order(1017..1037,1086..1097)
Misc Feature(21)1422..1430
Exon (1)1..444
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Exon (2)445..522
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Exon (3)523..616
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Exon (4)617..759
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Exon (5)760..929
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Exon (6)930..1059
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Exon (7)1060..1236
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Exon (8)1237..2117
Gene:PBK
Gene Synonym:CT84; HEL164; Nori-3; SPK; TOPK
Translation MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEM MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC TNEDPKDRPSAAHIVEALETDV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(63)-dbSNP:
complement(63)-t, cdbSNP:116239149
complement(88)-t, cdbSNP:186272043
complement(90)-t, cdbSNP:112318817
complement(171)-t, cdbSNP:28407456
complement(200)-t, cdbSNP:180705165
complement(235)-t, cdbSNP:144063110
complement(317)-t, cdbSNP:369481503
359+c, gdbSNP:11539583
365+a, gdbSNP:3735743
366+a, cdbSNP:3735744
complement(410)-t, cdbSNP:17057972
complement(416)-c, adbSNP:200576056
complement(445)-dbSNP:
complement(445)-t, cdbSNP:202051224
complement(468)-t, cdbSNP:150991972
complement(473)-t, cdbSNP:368149140
complement(483)-t, adbSNP:142678781
complement(498)-t, cdbSNP:374747017
complement(532)-dbSNP:
complement(532)-g, adbSNP:114501644
complement(553)-g, adbSNP:376363789
complement(563)-g, adbSNP:11539582
complement(575)-t, cdbSNP:55973425
complement(596)-g, adbSNP:35230929
complement(603)-g, adbSNP:199663154
complement(614)-t, gdbSNP:373317946
complement(636)-dbSNP:
complement(636)-g, adbSNP:200725164
complement(654)-t, cdbSNP:201032351
complement(672)-g, adbSNP:367624592
complement(691)-g, cdbSNP:369154408
complement(696)-g, adbSNP:112129421
complement(724)-t, adbSNP:62001048
784+dbSNP:
784+a, gdbSNP:3779620
complement(799)-t, cdbSNP:373579758
complement(801)-g, adbSNP:142068654
complement(815)-c, adbSNP:1675236
complement(820)-c, adbSNP:185478648
complement(844)-g, adbSNP:201842147
complement(853)-t, cdbSNP:371557868
complement(938)-dbSNP:
complement(938)-t, gdbSNP:201933253
complement(996)-t, cdbSNP:201290873
complement(1031)-g, cdbSNP:138952065
complement(1035)-g, adbSNP:370697278
complement(1038)-t, gdbSNP:200662690
complement(1072..1073)-dbSNP:
complement(1072..1073)-, cdbSNP:35061575
complement(1124)-g, cdbSNP:17057901
complement(1142)-g, adbSNP:369509839
complement(1157)-, adbSNP:370554380
complement(1185)-t, gdbSNP:36086402
1196+a, gdbSNP:2272691
complement(1218)-t, cdbSNP:143824466
complement(1234)-t, cdbSNP:116080983
complement(1273)-dbSNP:
complement(1273)-g, cdbSNP:141116063
complement(1285)-g, adbSNP:377305728
complement(1286)-g, cdbSNP:2294092
complement(1309)-t, gdbSNP:372784235
complement(1409)-g, adbSNP:112670476
complement(1427)-g, adbSNP:371650486
complement(1443)-g, cdbSNP:370636900
complement(1460)-t, gdbSNP:202048382
complement(1462)-g, adbSNP:1052873
1536+c, gdbSNP:1052874
complement(1606)-t, cdbSNP:182928344
complement(1610)-g, adbSNP:111683270
complement(1643)-c, adbSNP:6986820
complement(1746)-g, adbSNP:190773208
complement(1783)-t, adbSNP:115017161
complement(1786)-t, adbSNP:143110122
complement(1845)-g, adbSNP:112744328
complement(1947)-g, adbSNP:186276247
complement(1969..1970)-, agadbSNP:397976384
complement(1969)-t, adbSNP:79343602
complement(1970..1971)-, agadbSNP:72602653
complement(1972..1973)-, aag, agadbSNP:60576879
complement(1973..1974)-, aagdbSNP:149449393
complement(2046)-g, adbSNP:10092096
complement(2070)-t, cdbSNP:145754266
complement(2114..2116)-, tctdbSNP:57448874
complement(2116)-t, cdbSNP:201300164
Gene SymbolPBK
Gene SynonymCT84; HEL164; Nori-3; SPK; TOPK
Chromosome8
Locus Map8p21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018492 Homo sapiens PDZ binding kinase (PBK), transcript variant 1, mRNA. On-demand $159.00 7-9
NM_018492 Homo sapiens PDZ binding kinase (PBK), transcript variant 1, mRNA. On-demand $159.00 7-9
NM_018492 Homo sapiens PDZ binding kinase (PBK), transcript variant 1, mRNA. On-demand $159.00 7-9
Title Expression profiling of 519 kinase genes in matched malignant peripheral nerve sheath tumor/plexiform neurofibroma samples is discriminatory and identifies mitotic regulators BUB1B, PBK and NEK2 as overexpressed with transformation .
Author Stricker TP, Henriksen KJ, Tonsgard JH, Montag AG, Krausz TN and Pytel P.
Journal Mod. Pathol. 26 (7), 930-943 (2013)
Title c-Myc and E2F1 drive PBK/TOPK expression in high-grade malignant lymphomas .
Author Hu F, Gartenhaus RB, Zhao XF, Fang HB, Minkove S, Poss DE and Rapoport AP.
Journal Leuk. Res. 37 (4), 447-454 (2013)
Title Phosphorylation of IkappaBalpha at serine 32 by T-lymphokine-activated killer cell-originated protein kinase is essential for chemoresistance against doxorubicin in cervical cancer cells .
Author Park JH, Yoon DS, Choi HJ, Hahm DH and Oh SM.
Journal J. Biol. Chem. 288 (5), 3585-3593 (2013)
Title In silico structural and functional analysis of the human TOPK protein by structure modeling and molecular dynamics studies .
Author Kirubakaran P, Karthikeyan M, Singh KhD, Nagamani S and Premkumar K.
Journal J Mol Model 19 (1), 407-419 (2013)
Title Systematic antibody generation and validation via tissue microarray technology leading to identification of a novel protein prognostic panel in breast cancer .
Author O Leary PC, Penny SA, Dolan RT, Kelly CM, Madden SF, Rexhepaj E, Brennan DJ, McCann AH, Ponten F, Uhlen M, Zagozdzon R, Duffy MJ, Kell MR, Jirstrom K and Gallagher WM.
Journal BMC Cancer 13, 175 (2013)
Title Protein expression of PDZ-binding kinase is up-regulated in hematologic malignancies and strongly down-regulated during terminal differentiation of HL-60 leukemic cells .
Author Nandi A, Tidwell M, Karp J and Rapoport AP.
Journal Blood Cells Mol. Dis. 32 (1), 240-245 (2004)
Title PBK/TOPK is a novel mitotic kinase which is upregulated in Burkitt's lymphoma and other highly proliferative malignant cells .
Author Simons-Evelyn M, Bailey-Dell K, Toretsky JA, Ross DD, Fenton R, Kalvakolanu D and Rapoport AP.
Journal Blood Cells Mol. Dis. 27 (5), 825-829 (2001)
Title PDZ-binding kinase participates in spermatogenesis .
Author Zhao S, Dai J, Zhao W, Xia F, Zhou Z, Wang W, Gu S, Ying K, Xie Y and Mao Y.
Journal Int. J. Biochem. Cell Biol. 33 (6), 631-636 (2001)
Title Cloning and expression of a novel MAPKK-like protein kinase, lymphokine-activated killer T-cell-originated protein kinase, specifically expressed in the testis and activated lymphoid cells .
Author Abe Y, Matsumoto S, Kito K and Ueda N.
Journal J. Biol. Chem. 275 (28), 21525-21531 (2000)
Title Characterization of PDZ-binding kinase, a mitotic kinase .
Author Gaudet S, Branton D and Lue RA.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (10), 5167-5172 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.