• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu02816 Homo sapiens erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu02816C Homo sapiens erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_018538.3, 63054853
Length 1428 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2, mRNA.
Product erythroid membrane-associated protein precursor
Comment

Summary: The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) has an alternate 5' UTR and encodes the same protein, as compared to variant 1.


Sequence Note: This RefSeq record represents the ERMAP*001.1.1 allele.

RefSeq NP_061008.2
CDS 167..1594
Misc Feature(1)53..55
Misc Feature(2)278..595
Misc Feature(3)293..598
Misc Feature(4)632..694
Misc Feature(5)878..1402
Exon (1)1..161
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (2)162..251
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (3)252..599
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (4)600..716
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (5)717..749
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (6)750..782
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (7)783..803
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (8)804..824
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (9)825..851
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (10)852..878
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Exon (11)879..3351
Gene:ERMAP
Gene Synonym:BTN5; PRO2801; RD; SC
Translation MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVP KEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLED QGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQR RAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAV TLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVG DKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGI FLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE SIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27..28+dbSNP:
27..28+, tdbSNP:35354440
165+dbSNP:
165+a, gdbSNP:12124733
177+c, tdbSNP:35757049
178+a, gdbSNP:200586423
199+c, tdbSNP:202061674
203+a, gdbSNP:371361533
220+c, tdbSNP:33950227
230+c, tdbSNP:142166292
231+a, gdbSNP:374280865
242+c, tdbSNP:33953680
257+dbSNP:
257+a, gdbSNP:375116495
269+a, gdbSNP:146429994
280+c, tdbSNP:376310520
304+c, tdbSNP:150122881
305+a, gdbSNP:56047316
335+a, gdbSNP:56025238
344+c, gdbSNP:56136737
348+a, gdbSNP:375125882
350+g, tdbSNP:201419224
351+a, tdbSNP:200211952
378+c, tdbSNP:370783701
379+a, gdbSNP:200998492
383+c, tdbSNP:149787850
384+a, gdbSNP:146247630
385+c, tdbSNP:33954154
390+a, gdbSNP:199680522
407+c, tdbSNP:150664549
408+a, gdbSNP:368064875
417+a, cdbSNP:201143776
447+a, gdbSNP:373770988
460+a, gdbSNP:140203431
464+a, cdbSNP:375207937
473..474+, gadbSNP:387906265
473+, gdbSNP:55695242
474+, adbSNP:56151267
498+c, tdbSNP:201520271
515+a, gdbSNP:200355434
516+a, gdbSNP:183863963
519+c, tdbSNP:139264039
578+a, gdbSNP:200923604
593+a, gdbSNP:200071273
603+dbSNP:
603+a, cdbSNP:147125182
625+c, tdbSNP:149629031
664+a, gdbSNP:148290168
692+a, gdbSNP:146326745
724+dbSNP:
724+c, tdbSNP:370086635
741+c, tdbSNP:113445278
742+c, gdbSNP:374399714
745+a, gdbSNP:144054863
749+g, tdbSNP:367947427
773+dbSNP:
773+a, gdbSNP:145467732
779+a, cdbSNP:145158442
812+dbSNP:
812+c, tdbSNP:141803620
813+a, gdbSNP:139619405
814+g, tdbSNP:368569957
851+dbSNP:
851+a, gdbSNP:111499396
856+dbSNP:
856+a, gdbSNP:376742128
920+dbSNP:
920+a, cdbSNP:369842248
928+c, tdbSNP:142048901
941+c, tdbSNP:35147822
954+a, gdbSNP:34441268
973+a, tdbSNP:182900376
1001+a, gdbSNP:144048339
1032+c, tdbSNP:200208103
1054+a, gdbSNP:35972628
1058+c, tdbSNP:202198926
1087+c, tdbSNP:199745716
1097+a, gdbSNP:147550807
1099+c, tdbSNP:373556849
1102+a, gdbSNP:140414272
1117+a, gdbSNP:149186125
1135+a, cdbSNP:200901269
1142+a, gdbSNP:151336893
1151+c, tdbSNP:145639841
1161+a, gdbSNP:375678618
1179+a, gdbSNP:372550039
1197+c, tdbSNP:376388780
1201+a, gdbSNP:138178066
1215+a, gdbSNP:114373797
1230+c, tdbSNP:370816316
1232+c, tdbSNP:149293005
1265+a, gdbSNP:199698966
1317+a, cdbSNP:139771632
1336+c, tdbSNP:147144990
1341+a, gdbSNP:78655996
1363+c, tdbSNP:112212704
1393+a, g, tdbSNP:55773259
1414+c, tdbSNP:139926081
1461+c, gdbSNP:375385333
1476+c, tdbSNP:368560991
1490+c, tdbSNP:55872827
1505+a, cdbSNP:371514846
1521+c, tdbSNP:56405033
1522+g, tdbSNP:55677363
1544+c, tdbSNP:140583376
1547+c, gdbSNP:200590864
1580+g, tdbSNP:372626338
1610+c, gdbSNP:376639873
1614+, cdbSNP:56114654
1615+, tdbSNP:56337045
1616+, cdbSNP:55743534
1617+, cdbSNP:397927291
1618+, cdbSNP:397927292
1618+c, tdbSNP:367999242
1619+, adbSNP:56118622
1620+c, tdbSNP:371394455
1620+, tdbSNP:56385453
1621+, cdbSNP:56402024
1622+, adbSNP:55796893
1623+, cdbSNP:55654040
1624+, cdbSNP:397927293
1625+, adbSNP:56162482
1626+, tdbSNP:55784662
1627+, cdbSNP:55635535
1628+, cdbSNP:397927294
1629+, adbSNP:55984638
1630+, gdbSNP:55743227
1631+, cdbSNP:55916867
1632+, cdbSNP:397927295
1633+, cdbSNP:397927296
1634+, adbSNP:55644105
1635+, gdbSNP:56118789
1636+, cdbSNP:55732404
1637+, adbSNP:56301608
1638+, cdbSNP:55960611
1639+, cdbSNP:397927297
1640+, cdbSNP:397927298
1641+, tdbSNP:56182577
1642+, gdbSNP:55641750
1643+, gdbSNP:397927299
1644+, adbSNP:56194943
1645+, cdbSNP:56250959
1646+, tdbSNP:55653353
1647+, tdbSNP:397927300
1648+, cdbSNP:56280855
1649+, adbSNP:55959816
1650+, gdbSNP:56244726
1651+, tdbSNP:55674665
1652+, cdbSNP:56004199
1652+c, tdbSNP:187852675
1653+, gdbSNP:55974652
1654+, cdbSNP:56230324
1655+, cdbSNP:397927301
1656+, tdbSNP:55787016
1657+, gdbSNP:55699128
1658+, gdbSNP:397927302
1659+, cdbSNP:56057457
1660+, cdbSNP:397927303
1661+, cdbSNP:397927304
1662+, adbSNP:55848288
1663+, adbSNP:397927305
1664+, cdbSNP:55653914
1665+, cdbSNP:397927306
1666+, cdbSNP:397927307
1667+, cdbSNP:397927308
1668+, adbSNP:56108687
1669+, tdbSNP:56084400
1670+, gdbSNP:55879312
1671+, adbSNP:56067776
1672+, tdbSNP:55637205
1673+, tdbSNP:397927309
1674+, adbSNP:56222802
1675+, tdbSNP:56013283
1676+, gdbSNP:55854916
1677+, gdbSNP:397927310
1678+, adbSNP:55670427
1679+, adbSNP:397927311
1680+, cdbSNP:56075886
1680+c, tdbSNP:111730740
1681+, gdbSNP:55861457
1682+, tdbSNP:56376425
1683+, cdbSNP:55764458
1684+, tdbSNP:56265936
1685+, cdbSNP:56233652
1685+c, gdbSNP:147712296
1686+, tdbSNP:55968601
1687+, tdbSNP:397927312
1688+, cdbSNP:55980411
1689+, adbSNP:55730151
1690+, cdbSNP:55727621
1691+, cdbSNP:397927313
1692+, tdbSNP:55735130
1693+, tdbSNP:397927314
1694+, adbSNP:55899905
1695+, adbSNP:397927315
1696+, cdbSNP:55794160
1697+, cdbSNP:397927316
1698+, cdbSNP:397927317
1699+, adbSNP:55744126
1700+, adbSNP:397927318
1700+a, gdbSNP:142454045
1701+, adbSNP:397927319
1702+, tdbSNP:56355315
1703+, cdbSNP:55741278
1704+, cdbSNP:397927320
1705+, adbSNP:55755213
1706+, gdbSNP:56297241
1707+, adbSNP:55688761
1708+, cdbSNP:55677606
1709+, cdbSNP:397927321
1710+, cdbSNP:397927322
1711+, tdbSNP:55944449
1712+, tdbSNP:397927323
1713+, tdbSNP:397927324
1714+, tdbSNP:397927325
1715+, gdbSNP:55645660
1716+, tdbSNP:55756420
1717+, gdbSNP:55793594
1718+, gdbSNP:397927326
1719+, tdbSNP:55757064
1720+, tdbSNP:397927327
1721+, tdbSNP:397927328
1722+, cdbSNP:56270036
1723+, tdbSNP:55846429
1724+, adbSNP:56192855
1725+, tdbSNP:55676267
1726+, tdbSNP:397927329
1727+, tdbSNP:397927330
1728+, gdbSNP:56374219
1729+, tdbSNP:55788000
1730+, adbSNP:56317219
1731+, cdbSNP:55885207
1732+, cdbSNP:397927331
1733+, adbSNP:55927653
1734+, cdbSNP:55815188
1735+, tdbSNP:55996336
1736+, tdbSNP:397927332
1737+, tdbSNP:397927333
1738+, tdbSNP:397927334
1739+, cdbSNP:55997567
1740+, tdbSNP:56271913
1741+, cdbSNP:56212779
1742+, cdbSNP:397927335
1743+, cdbSNP:397927336
1744+, adbSNP:55706193
1745+, gdbSNP:55639370
1746+, gdbSNP:397927337
1747+, cdbSNP:55685637
1748+, cdbSNP:397927338
1749+, tdbSNP:56231500
1750+, cdbSNP:56056528
1751+, adbSNP:56384554
1752+, gdbSNP:55801429
1753+, tdbSNP:55920618
1754+, tdbSNP:397927339
1755+, cdbSNP:55900350
1756+, tdbSNP:55905593
1757+, gdbSNP:55941706
1758+, adbSNP:56071195
1759+, adbSNP:397927340
1760+, gdbSNP:56062735
1761+, cdbSNP:55704502
1762+, tdbSNP:55859653
1763+, tdbSNP:397927341
1764+, adbSNP:55750078
1765+, cdbSNP:55907519
1766+, cdbSNP:397927342
1767+, tdbSNP:55641810
1768+, tdbSNP:397927343
1769+, tdbSNP:397927344
1770+, cdbSNP:56328492
1771+, tdbSNP:56214203
1772+, tdbSNP:397927345
1773+, cdbSNP:56265118
1774+, tdbSNP:55668564
1775+, adbSNP:56361506
1776+, adbSNP:397927346
1777+, gdbSNP:56119157
1778+, gdbSNP:397927347
1779+, adbSNP:55712347
1780+, adbSNP:397927348
1781+, tdbSNP:55738880
1782+, tdbSNP:397927349
1783+, gdbSNP:55699614
1784+, adbSNP:55865153
1785+, adbSNP:397927350
1786+, gdbSNP:55727316
1787+, cdbSNP:56190089
1788+, tdbSNP:55787642
1789+, cdbSNP:55958825
1790+, cdbSNP:397927351
1791+, cdbSNP:397927352
1792+, adbSNP:56075995
1793+, gdbSNP:56229137
1794+, tdbSNP:55934838
1795+, gdbSNP:56097329
1796+, adbSNP:56343941
1797+, cdbSNP:55653879
1798+, cdbSNP:397927353
1799+, tdbSNP:55803306
1800+, gdbSNP:55942526
1801+, gdbSNP:397927354
1802+, adbSNP:56349813
1803+, gdbSNP:55792493
1804+, gdbSNP:397927355
1805+, gdbSNP:397927356
1806+, adbSNP:55779740
1807+, gdbSNP:55845411
1808+, gdbSNP:397927357
1809+, adbSNP:56140847
1810+, tdbSNP:55675333
1811+, tdbSNP:397927358
1812+, cdbSNP:55795653
1813+, cdbSNP:397927359
1814+, tdbSNP:56004308
1815+, gdbSNP:56380639
1816+, gdbSNP:397927360
1817+, adbSNP:55820603
1818+, adbSNP:397927361
1819+, adbSNP:397927362
1820+, cdbSNP:55816707
1821+, cdbSNP:397927363
1822+, adbSNP:55907123
1823+, adbSNP:397927364
1824+, adbSNP:397927365
1824+a, gdbSNP:371163467
1825+, cdbSNP:56007842
1826+, adbSNP:55694853
1827+, adbSNP:397927366
1828+, tdbSNP:55848962
1829+, cdbSNP:55781619
1830+, adbSNP:56016027
1831+, gdbSNP:56067209
1832+, tdbSNP:55758197
1833+, tdbSNP:397927367
1834+, tdbSNP:397927368
1835+, adbSNP:55706179
1836+, gdbSNP:55716936
1837+, gdbSNP:397927369
1838+, tdbSNP:56196569
1839+, gdbSNP:55865133
1840+, cdbSNP:55852711
1841+, adbSNP:55728575
1842+, gdbSNP:55768217
1843+, gdbSNP:397927370
1844+, tdbSNP:56389498
1845+, gdbSNP:56027711
1846+, gdbSNP:397927371
1847+, adbSNP:55897293
1848+, gdbSNP:55696339
1849+, adbSNP:56317432
1850+, tdbSNP:56294641
1851+, gdbSNP:56299800
1852+, tdbSNP:55992222
1853+, tdbSNP:397927372
1854+, gdbSNP:56098946
1855+, adbSNP:56017910
1856+, adbSNP:397927373
1857+, tdbSNP:56046404
1858+, adbSNP:376678939
1858+a, gdbSNP:7552363
1859+, tdbSNP:55827493
1860+, gdbSNP:55892406
1861+, tdbSNP:55714413
1862+, gdbSNP:55772402
1863+, tdbSNP:55782975
1864+, tdbSNP:397927374
1865+, adbSNP:56066336
1866+, cdbSNP:55821830
1867+, cdbSNP:397927375
1868+, adbSNP:55729422
1869+, adbSNP:397927376
1870+, gdbSNP:56077055
1871+, adbSNP:55825326
1872+, tdbSNP:55969116
1873+, adbSNP:56353975
1874+, cdbSNP:55842632
1875+, adbSNP:56178376
1876+, gdbSNP:56098129
1877+, cdbSNP:55999402
1878+, adbSNP:55945332
1879+, cdbSNP:55978870
1880+, adbSNP:56020542
1881+, gdbSNP:55752274
1882+, gdbSNP:397927377
1883+, tdbSNP:55658529
1884+, tdbSNP:397927378
1885+, cdbSNP:55798360
1886+, adbSNP:55875428
1887+, gdbSNP:55652921
1888+, gdbSNP:397927379
1889+, gdbSNP:397927380
1890+, adbSNP:55674463
1891+, adbSNP:397927381
1892+, adbSNP:397927382
1893+, adbSNP:397927383
1894+, gdbSNP:56351144
1895+, adbSNP:55932853
1896+, gdbSNP:56391328
1897+, tdbSNP:55997282
1898+, tdbSNP:397927384
1899+, cdbSNP:56129662
1900+a, gdbSNP:11806407
1900+, gdbSNP:374574996
1901+, cdbSNP:55958217
1902+, tdbSNP:56253204
1903+, adbSNP:56217475
1904+, cdbSNP:55958279
1905+, tdbSNP:56278962
1906+, cdbSNP:55827431
1907+, cdbSNP:397927385
1908+, adbSNP:56159426
1909+, gdbSNP:55850218
1910+, gdbSNP:397927386
1911+, gdbSNP:397927387
1912+, gdbSNP:397927388
1913+, tdbSNP:55999503
1914+, tdbSNP:397927389
1915+, adbSNP:56287892
1916+, tdbSNP:55637787
1917+, tdbSNP:397927390
1918+, tdbSNP:397927391
1919+, adbSNP:55654355
1920+, gdbSNP:55655415
1921+, adbSNP:55849239
1922+, adbSNP:370740419
1922+a, gdbSNP:35728345
1923+, gdbSNP:55645179
1924+, adbSNP:56238607
1925+, cdbSNP:56258396
1926+, adbSNP:56107347
1927+, cdbSNP:56370609
1928+, tdbSNP:56055391
1929+, tdbSNP:397927392
1930+, tdbSNP:397927393
1931+, cdbSNP:56266950
1932+, tdbSNP:55822241
1933+, cdbSNP:55804562
1934+, tdbSNP:56333742
1935+, gdbSNP:55820663
1936+, cdbSNP:55650422
1937+, cdbSNP:397927394
1938+, tdbSNP:56303584
1939+, cdbSNP:55680556
1940+, adbSNP:55919002
1941+, tdbSNP:56333375
1942+, cdbSNP:55633547
1943+, cdbSNP:397927395
1944+, tdbSNP:56174654
1945+, gdbSNP:56199896
1946+, cdbSNP:55675559
1947+, cdbSNP:397927396
1948+, cdbSNP:397927397
1949+, tdbSNP:55975110
1950+, cdbSNP:56078822
1951+, adbSNP:55808411
1952+, adbSNP:397927398
1953+, gdbSNP:55845126
1954+, cdbSNP:56222716
1955+, tdbSNP:55892160
1956+, tdbSNP:397927399
1957+, tdbSNP:397927400
1958+, adbSNP:55645939
1959+, gdbSNP:55737629
1960+, tdbSNP:55755748
1961+, cdbSNP:55904806
1962+, adbSNP:55905798
1963+, adbSNP:397927401
1964+, gdbSNP:56112624
1965+, adbSNP:55904539
1966+, adbSNP:397927402
1967+, gdbSNP:56246304
1968+, tdbSNP:55923012
1969+, tdbSNP:397927403
1970+, adbSNP:56380550
1971+, tdbSNP:55694904
1972+, gdbSNP:55664714
1973+, gdbSNP:397927404
1974+, cdbSNP:55658463
1975+, cdbSNP:397927405
1976+, cdbSNP:397927406
1977+, cdbSNP:397927407
1978+, cdbSNP:397927408
1979+, adbSNP:56124205
1980+, gdbSNP:55873667
1981+, tdbSNP:56192433
1982+, cdbSNP:55778750
1983+, cdbSNP:397927409
1984+, cdbSNP:397927410
1985+, tdbSNP:55853757
1986+, gdbSNP:56288059
1987+, adbSNP:55854842
1988+, cdbSNP:56354012
1989+, tdbSNP:56160194
1990+, tdbSNP:397927411
1991+, cdbSNP:56009809
1992+, tdbSNP:55917443
1993+, tdbSNP:397927412
1994+, adbSNP:56128233
1995+, cdbSNP:56319806
1996+, tdbSNP:55730551
1997+, tdbSNP:397927413
1998+, adbSNP:56069456
1999+, tdbSNP:55795363
2000+, cdbSNP:56072218
2001+, cdbSNP:397927414
2002+, cdbSNP:397927415
2003+, adbSNP:55670642
2004+, tdbSNP:56145341
2005+, tdbSNP:397927416
2006+, gdbSNP:55721340
2007+, adbSNP:55790264
2008+, gdbSNP:55927032
2009+, gdbSNP:397927417
2010+, adbSNP:55945659
2011+, cdbSNP:55943906
2012+, tdbSNP:55803957
2013+, gdbSNP:55646898
2014+, cdbSNP:55645118
2015+, cdbSNP:397927418
2016+, tdbSNP:55638657
2017+, tdbSNP:397927419
2018+, tdbSNP:397927420
2019+, cdbSNP:56385554
2020+, tdbSNP:55881993
2021+, cdbSNP:55744117
2022+, tdbSNP:55838705
2023+, cdbSNP:55824905
2024+, tdbSNP:55878930
2025+, cdbSNP:56062113
2026+, tdbSNP:56047395
2027+, cdbSNP:56176938
2028+, adbSNP:56231412
2029+, gdbSNP:55787020
2030+, tdbSNP:55934135
2031+, tdbSNP:397927421
2032+, cdbSNP:56259988
2033+, tdbSNP:56279618
2034+, gdbSNP:55691450
2035+, gdbSNP:397927422
2036+, cdbSNP:56057381
2037+, cdbSNP:397927423
2038+, tdbSNP:56090438
2039+, cdbSNP:56147406
2040+, tdbSNP:56139868
2041+, gdbSNP:55927516
2042+, cdbSNP:55867609
2043+, cdbSNP:397927424
2044+, cdbSNP:397927425
2045+, cdbSNP:397927426
2046+a, cdbSNP:138784902
2046+, cdbSNP:397927427
2047+, cdbSNP:397927428
2048+, adbSNP:55740370
2049+, adbSNP:397927429
2050+, adbSNP:397927430
2051+, gdbSNP:55680065
2052+, tdbSNP:55737207
2053+, cdbSNP:56393947
2054+, adbSNP:55967954
2055+, gdbSNP:55871032
2056+, cdbSNP:56115081
2057+, tdbSNP:55666342
2058+, cdbSNP:375792908
2058+c, tdbSNP:11809718
2059+, tdbSNP:56027788
2060+, cdbSNP:55680354
2061+, tdbSNP:56086943
2062+, adbSNP:55710739
2063+, adbSNP:397927431
2064+, adbSNP:397927432
2065+, adbSNP:397927433
2066+, gdbSNP:55712701
2067+, cdbSNP:55954847
2068+, adbSNP:55931460
2069+, adbSNP:397927434
2070+, gdbSNP:56058417
2071+, cdbSNP:55994322
2072+, adbSNP:55706163
2073+, tdbSNP:56204477
2074..2075+, tdbSNP:3214967
2074+a, cdbSNP:199946252
2074+, gdbSNP:56184880
2075+, tdbSNP:55986603
2076+, tdbSNP:397927435
2077+, tdbSNP:397927436
2078..2079+, tdbSNP:397791938
2078+, tdbSNP:397927437
2079+, adbSNP:56265447
2080+, gdbSNP:56346041
2081+, adbSNP:55725523
2082+, cdbSNP:56273528
2083+, cdbSNP:397927438
2084+, adbSNP:55930660
2085+, cdbSNP:56317365
2086+, tdbSNP:55749819
2087+, cdbSNP:56021328
2088+, adbSNP:55782245
2089+, cdbSNP:56347680
2090+, tdbSNP:56358273
2091+, cdbSNP:55722263
2092+, tdbSNP:55681345
2093+, tdbSNP:397927439
2094+, tdbSNP:397927440
2095+, cdbSNP:55716504
2096+, cdbSNP:397927441
2097+, cdbSNP:397927442
2098+, tdbSNP:56188330
2099+, cdbSNP:55665817
2100+, tdbSNP:55736179
2101+, tdbSNP:397927443
2102+, tdbSNP:397927444
2103+, cdbSNP:56245403
2104+, tdbSNP:55836613
2105+, tdbSNP:397927445
2106+, cdbSNP:56187932
2107+, adbSNP:56003200
2108+a, gdbSNP:75304294
2108+, gdbSNP:55636840
2109+, gdbSNP:397927446
2110+, adbSNP:55750958
2111+, adbSNP:397927447
2112+, tdbSNP:56269300
2113+, gdbSNP:55718156
2114+, adbSNP:55817916
2115+, adbSNP:397927448
2116+, tdbSNP:55813019
2117+, tdbSNP:397927449
2118+, gdbSNP:55693137
2119+, gdbSNP:397927450
2120+, gdbSNP:397927451
2121+, adbSNP:55996826
2122+, adbSNP:397927452
2123+, adbSNP:397927453
2124+, gdbSNP:55680432
2125+, gdbSNP:397927454
2126+, cdbSNP:56272156
2127+, tdbSNP:55872765
2128+, gdbSNP:55907041
2129+, adbSNP:55679152
2130+, tdbSNP:56219510
2131+, gdbSNP:55796416
2132+, adbSNP:56046606
2133+, gdbSNP:56393191
2134+, tdbSNP:56215297
2135+, adbSNP:55887110
2136+, adbSNP:397927455
2137+, adbSNP:397927456
2138+, adbSNP:397927457
2139+, cdbSNP:56220389
2140+, adbSNP:56084862
2141+, tdbSNP:56368876
2142+, adbSNP:56177381
2143+, cdbSNP:55994971
2144+, cdbSNP:397927458
2145+, adbSNP:56206560
2146+, tdbSNP:55855873
2147+, cdbSNP:55728975
2148+, cdbSNP:397927459
2149+, tdbSNP:55739446
2150+, tdbSNP:397927460
2151+, tdbSNP:397927461
2152+, tdbSNP:397927462
2153+, cdbSNP:55831518
2154+, tdbSNP:56106048
2155+, adbSNP:56047174
2156+, tdbSNP:55833148
2157+, tdbSNP:397927463
2158+, tdbSNP:397927464
2159+, tdbSNP:397927465
2160+, cdbSNP:55806637
2161+, tdbSNP:56072046
2162+, tdbSNP:397927466
2163+, gdbSNP:55654202
2164+, adbSNP:55931118
2165+, tdbSNP:55934768
2166+, gdbSNP:55944567
2167+, cdbSNP:55678436
2168+, tdbSNP:56110546
2169+, gdbSNP:55657154
2170+, tdbSNP:55771106
2171+, tdbSNP:397927467
2172+, tdbSNP:397927468
2173+, adbSNP:56211673
2174+, cdbSNP:56332742
2175+, adbSNP:55792353
2176+, adbSNP:397927469
2177+, cdbSNP:55789000
2178+, adbSNP:55639315
2179+, tdbSNP:56358310
2180+, adbSNP:56228731
2181+, gdbSNP:55804263
2182+, tdbSNP:55640736
2183+, tdbSNP:397927470
2184+, tdbSNP:397927471
2185+, gdbSNP:56075819
2186+, gdbSNP:397927472
2187+, tdbSNP:55743983
2188+, gdbSNP:56122900
2189+, adbSNP:56238711
2190+, tdbSNP:56362418
2191+, adbSNP:56197228
2192+, tdbSNP:56346047
2193+, cdbSNP:56158400
2194+, cdbSNP:397927473
2195+, adbSNP:55681924
2196+, gdbSNP:55883345
2197+, adbSNP:55804015
2198+, gdbSNP:56408189
2199+, cdbSNP:55722440
2200+, tdbSNP:55635045
2201+, adbSNP:55800431
2202+, adbSNP:397927474
2203+, tdbSNP:55748656
2204+, gdbSNP:56097247
2205+, tdbSNP:56016661
2206+, adbSNP:56021032
2207+, cdbSNP:55867155
2208+, adbSNP:56271759
2208+a, gdbSNP:149363495
2209+, tdbSNP:56064532
2210+, gdbSNP:55899729
2211+, cdbSNP:55936698
2212+, tdbSNP:55769625
2213+, tdbSNP:397927475
2214+, tdbSNP:397927476
2215+, cdbSNP:55995132
2216+, adbSNP:55814130
2217+, adbSNP:397927477
2218+, adbSNP:397927478
2219+, adbSNP:397927479
2220+, gdbSNP:55957610
2221+, cdbSNP:56032812
2222+, tdbSNP:56339666
2223+, adbSNP:55742287
2224+, adbSNP:397927480
2225+, tdbSNP:56283771
2226+, cdbSNP:56178958
2227+, tdbSNP:56365333
2228+, gdbSNP:55932426
2229+, cdbSNP:55740468
2230+, cdbSNP:397927481
2231+, tdbSNP:56192337
2232+, gdbSNP:56136670
2233+, tdbSNP:55675135
2234+, tdbSNP:397927482
2235+, gdbSNP:55770632
2236+, adbSNP:55730027
2237+, tdbSNP:56362177
2238+, gdbSNP:55966464
2239+a, gdbSNP:1484324
2240+, tdbSNP:55860026
2241+, adbSNP:55662098
2242+, adbSNP:397927483
2243+, cdbSNP:56097915
2244+, tdbSNP:55790629
2245+, adbSNP:56189426
2246+, gdbSNP:56038354
2247+, gdbSNP:397927484
2248+, tdbSNP:56147281
2249+, adbSNP:56184229
2250+, cdbSNP:55736585
2251+, adbSNP:55658387
2252+, gdbSNP:55936316
2253+, cdbSNP:55668134
2254+, gdbSNP:55698019
2255+, adbSNP:56346363
2256+, cdbSNP:56335617
complement(2257)-t, gdbSNP:143650172
2257+, tdbSNP:55669543
2258+, tdbSNP:397927485
2259+, tdbSNP:397927486
2260+, adbSNP:55688769
2261+, adbSNP:397927487
2262+, adbSNP:397927488
2263+, tdbSNP:56368805
2264+, adbSNP:56280441
2265+, cdbSNP:56236758
2266+, adbSNP:55722918
2267+, gdbSNP:56201346
2268+, tdbSNP:55824041
2269+, tdbSNP:397927489
2270+, gdbSNP:56237855
2271+, cdbSNP:56257814
2272+, tdbSNP:55809254
2273+, adbSNP:56336024
2274+, tdbSNP:55973283
2275+, adbSNP:56065439
2276+, adbSNP:397927490
2277+, tdbSNP:55829049
2278+, cdbSNP:55682524
2279+, cdbSNP:397927491
2280+, tdbSNP:56181014
2281+, gdbSNP:55699384
2282+, adbSNP:55716295
2283+, adbSNP:397927492
2284+, adbSNP:397927493
2285+, adbSNP:397927494
2286+, gdbSNP:56121212
2287+, cdbSNP:55767802
2288+, cdbSNP:397927495
2289+, cdbSNP:397927496
2290+, cdbSNP:397927497
2291+, adbSNP:56375704
2292+, gdbSNP:55693065
2293+, gdbSNP:397927498
2294+, adbSNP:56209443
2295+, gdbSNP:56230238
2296+, cdbSNP:56389946
2297+, adbSNP:56389672
2298+, cdbSNP:56317143
2299+, adbSNP:56371935
2300+, tdbSNP:55865375
2301+, cdbSNP:55847456
2302+, adbSNP:56284388
2303+, gdbSNP:55728297
2304+, gdbSNP:397927499
2305+, gdbSNP:397927500
2306+, adbSNP:55809627
2307+, gdbSNP:56121387
2308+, cdbSNP:55983114
2309+, tdbSNP:55888930
2310+, gdbSNP:55724612
2311+, gdbSNP:397927501
2312+, gdbSNP:397927502
2314+, adbSNP:55976020
2315+, adbSNP:397927503
2316+, cdbSNP:56047663
2317+, adbSNP:56240330
2318+, cdbSNP:56093983
2319+, adbSNP:56290222
2320+, gdbSNP:56099855
2321+, tdbSNP:55748002
2322+, tdbSNP:397927504
2323+, gdbSNP:56161880
2324+, cdbSNP:55954187
2325+, adbSNP:56210615
2326+, gdbSNP:55948652
2327+, adbSNP:56078037
2328+, gdbSNP:55824031
2329+, adbSNP:55802274
2330+, adbSNP:397927505
2331+, cdbSNP:55956523
2332+, tdbSNP:56003890
2333+, cdbSNP:56362928
2334+, adbSNP:55670459
2335+, gdbSNP:55802327
2336+, cdbSNP:55744702
2337+, tdbSNP:56163127
2338+, gdbSNP:55767244
2339+, tdbSNP:56008643
2340+, adbSNP:56128346
2341+, tdbSNP:55840019
2342+, gdbSNP:55808571
2343+, tdbSNP:55646796
2344+, tdbSNP:397927506
2345+, gdbSNP:55982223
2346+, cdbSNP:55815933
2347+, cdbSNP:397927507
2348+, cdbSNP:397927508
2349+, tdbSNP:55775519
2350+, cdbSNP:56202257
2351+, tdbSNP:56171227
2352+, gdbSNP:55674363
2353+, adbSNP:55754308
2354+, cdbSNP:55859213
2355+, cdbSNP:397927509
2356+, tdbSNP:55890644
2357+, tdbSNP:397927510
2358+, gdbSNP:55946542
2359+, gdbSNP:397927511
2360+, cdbSNP:55664504
2361+, cdbSNP:397927512
2362+, cdbSNP:397927513
2363+, adbSNP:56242330
2364+, gdbSNP:55896481
2365+, adbSNP:55943671
2366+, cdbSNP:55951652
2367+, cdbSNP:397927514
2368+, tdbSNP:55780610
2369+, tdbSNP:397927515
2370+, cdbSNP:56381866
2371+, adbSNP:55980158
2372+, gdbSNP:56079354
2373+, adbSNP:55645643
2374+, gdbSNP:55633454
2375+, gdbSNP:397927516
2376+, cdbSNP:56227949
2377+, tdbSNP:55833434
2378+, cdbSNP:55727560
2379+, adbSNP:55972059
2380+, gdbSNP:55664142
2381+, tdbSNP:56346037
2382+, cdbSNP:55902240
2383+, tdbSNP:56401443
2384+, gdbSNP:56182619
2385+, tdbSNP:56076709
2386+, tdbSNP:397927517
2387+, gdbSNP:56045221
2388+, adbSNP:56391905
2389+, gdbSNP:55868812
2390+, tdbSNP:55695035
2391+, cdbSNP:55861273
2392+, tdbSNP:56331888
2393+, gdbSNP:56092414
2394+, tdbSNP:56302745
2395+, tdbSNP:397927518
2396+, gdbSNP:55878414
2397+g, tdbSNP:56137748
2400+c, tdbSNP:55824569
2401+a, tdbSNP:55679828
2402+g, tdbSNP:56174738
2403+g, tdbSNP:55818576
2405+c, tdbSNP:56315419
2406+a, tdbSNP:55782860
2407+a, cdbSNP:56025931
2408+a, tdbSNP:55952349
2409+g, tdbSNP:55865130
2410+a, tdbSNP:55670402
2412+c, tdbSNP:55722189
2414+a, tdbSNP:56192257
2415+a, gdbSNP:56225553
2416+c, tdbSNP:55838365
2433+c, tdbSNP:370965185
2465+a, gdbSNP:192334866
2470..2471+, gdbSNP:140325884
2472+a, cdbSNP:202013859
2533+c, gdbSNP:10789428
2553+c, tdbSNP:111258470
2559+a, gdbSNP:34118468
2656+c, tdbSNP:34318657
2716+c, tdbSNP:36098574
2723+c, tdbSNP:148274743
2738+a, gdbSNP:61739633
2752+a, gdbSNP:141798546
2839+, gdbSNP:199710761
2846+c, gdbSNP:182956465
2880+c, tdbSNP:34032942
2909+a, gdbSNP:11806841
3018+a, gdbSNP:34137903
3120+a, gdbSNP:34423918
3330+a, gdbSNP:12406279
Gene SymbolERMAP
Gene SynonymBTN5; PRO2801; RD; SC
Chromosome1
Locus Map1p34.2
Title SC*994C>T causes the Sc(null) phenotype in Pacific Islanders and successful transfusion of Sc3+ blood to a patient with anti-Sc3 .
Author Reid ME, Hue-Roye K, Velliquette RW, Larimore K, Moscarelli S, Ohswaldt N and Lomas-Francis C.
Journal Immunohematology 29 (2), 69-72 (2013)
Title The polymorphism nt 76 in exon 2 of SC is more frequent in whites than in blacks .
Author Fuchisawa A, Lomas-Francis C, Hue-Roye K and Reid ME.
Journal Immunohematology 25 (1), 18-19 (2009)
Title [Expression of human ermap gene in umbilical cord blood mononuclear cells during differentiation and development towards erythroid lineage] .
Author Lin LD, He XR, Ye TZ, He YY, Guan JM, Chen Y and Liang JF.
Journal Zhongguo Shi Yan Xue Ye Xue Za Zhi 16 (2), 328-332 (2008)
Title SCER and SCAN: two novel high-prevalence antigens in the Scianna blood group system .
Author Flegel WA, Chen Q, Reid ME, Martin J, Orsini LA, Poole J, Moulds MK and Wagner FF.
Journal Transfusion 45 (12), 1940-1944 (2005)
Title ABO, Rh, MNS, Duffy, Kidd,Yt, Scianna, and Colton blood group systems in indigenous Chinese .
Author Yan L, Zhu F, Fu Q and He J.
Journal Immunohematology 21 (1), 10-14 (2005)
Title Scianna antigens including Rd are expressed by ERMAP .
Author Wagner FF, Poole J and Flegel WA.
Journal Blood 101 (2), 752-757 (2003)
Title Human ERMAP: an erythroid adhesion/receptor transmembrane protein .
Author Su YY, Gordon CT, Ye TZ, Perkins AC and Chui DH.
Journal Blood Cells Mol. Dis. 27 (5), 938-949 (2001)
Title Cloning and characterization of human erythroid membrane-associated protein, human ERMAP .
Author Xu H, Foltz L, Sha Y, Madlansacay MR, Cain C, Lindemann G, Vargas J, Nagy D, Harriman B, Mahoney W and Schueler PA.
Journal Genomics 76 (1-3), 2-4 (2001)
Title The position of the Radin blood group locus in relation to other chromosome l loci .
Author Lewis,M., Kaita,H., Philipps,S., Giblett,E.R., Anderson,J.E., McAlpine,P.J. and Nickel,B.
Journal Ann. Hum. Genet. 44 (PT 2), 179-184 (1980)
Title Genetic linkage between the Radin and Rh blood group loci .
Author Lewis,M. and Kaita,H.
Journal Vox Sang. 37 (5), 286-289 (1979)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.