• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 16, member 10 (aromatic amino acid transporter) (SLC16A10), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_018593 Homo sapiens solute carrier family 16, member 10 (aromatic amino acid transporter) (SLC16A10), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_018593.4, 221139821
Length 2918 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 16, member 10 (aromatic amino acid transporter) (SLC16A10), mRNA.
Product monocarboxylate transporter 10
Comment

Summary: SLC16A10 is a member of a family of plasma membrane amino acid transporters that mediate the Na(+)-independent transport of aromatic amino acids across the plasma membrane.[supplied by OMIM, Apr 2004].

RefSeq NP_061063.2
CDS 176..1723
Misc Feature(1)125..127
Misc Feature(2)374..436
Misc Feature(3)374..436
Misc Feature(4)380..1636
Misc Feature(5)386..1585
Misc Feature(6)order(428..430,437..442,452..454,458..463,527..529,
Misc Feature(7)518..580
Misc Feature(8)608..670
Misc Feature(9)689..751
Misc Feature(10)776..838
Misc Feature(11)860..922
Misc Feature(12)1049..1111
Misc Feature(13)1163..1225
Misc Feature(14)1229..1291
Misc Feature(15)1364..1426
Misc Feature(16)1433..1495
Misc Feature(17)1529..1591
Misc Feature(18)1667..1669
Exon (1)1..518
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (2)519..663
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (3)664..1117
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (4)1118..1261
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (5)1262..1490
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (6)1491..2893
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Translation MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHE PPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSL SMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGC SFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIF MFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGI PLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVY LQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREI SKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+dbSNP:
52+a, gdbSNP:34764396
418+a, cdbSNP:201455367
427+a, gdbSNP:145655903
457+c, tdbSNP:141109745
486+c, gdbSNP:145047809
491+a, gdbSNP:147581822
538+dbSNP:
538+c, tdbSNP:200765141
559+c, tdbSNP:142071847
574+c, tdbSNP:33965856
614+a, gdbSNP:148349506
646+c, gdbSNP:140564027
737+dbSNP:
737+c, tdbSNP:150478295
754+c, gdbSNP:138486397
805+c, tdbSNP:116051634
896+a, cdbSNP:200192335
913+c, gdbSNP:142734633
973+c, tdbSNP:77208843
1034+a, gdbSNP:116322832
1126+dbSNP:
1126+c, tdbSNP:149374548
1162+a, gdbSNP:188894873
1183+c, tdbSNP:181746758
1202+c, tdbSNP:202085593
1210+c, gdbSNP:113965591
1217+c, tdbSNP:200813678
1277+dbSNP:
1277+g, tdbSNP:201626230
1285+c, tdbSNP:144758557
1289+a, cdbSNP:148659008
1392+c, tdbSNP:200015784
1434+c, tdbSNP:142185010
1544+dbSNP:
1544+a, gdbSNP:115674232
1593+a, gdbSNP:114460402
1594+c, tdbSNP:147422659
1650+a, tdbSNP:183836560
1655..1656+, atdbSNP:10698023
1697+a, cdbSNP:17072442
1798+a, gdbSNP:118149501
1863+c, tdbSNP:189096229
1942..1943+, acdbSNP:201576847
1943..1944+, atdbSNP:148728349
1944..1945+, atdbSNP:34198423
1944..1945+, atdbSNP:72563616
1945..1946+, atdbSNP:34214262
1945+a, gdbSNP:201153583
1947+c, gdbSNP:199803669
2030+a, gdbSNP:10457235
2145+c, tdbSNP:73532731
2229+a, cdbSNP:14399
2573..2574+, aaac, caaadbSNP:151328273
2574..2575+, aaacdbSNP:66698226
2576..2577+, caaadbSNP:10680262
2577..2578+, caaadbSNP:35133411
2830..2831+, tdbSNP:150351279
2833..2834+, tdbSNP:71838611
2868+a, gdbSNP:140163540
Gene SymbolSLC16A10
Gene SynonymMCT10; PRO0813; TAT1
Chromosome6
Locus Map6q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018593 Homo sapiens solute carrier family 16, member 10 (aromatic amino acid transporter) (SLC16A10), mRNA. On-demand TBD TBD
Title Genome-wide association study identifies multiple loci influencing human serum metabolite levels .
Author Kettunen,J., Tukiainen,T., Sarin,A.P., Ortega-Alonso,A., Tikkanen,E., Lyytikainen,L.P., Kangas,A.J., Soininen,P., Wurtz,P., Silander,K., Dick,D.M., Rose,R.J., Savolainen,M.J., Viikari,J., Kahonen,M., Lehtimaki,T., Pietilainen,K.H., Inouye,M., McCarthy,M.I., Jula,A., Eriksson,J., Raitakari,O.T., Salomaa,V., Kaprio,J., Jarvelin,M.R., Peltonen,L., Perola,M., Freimer,N.B., Ala-Korpela,M., Palotie,A. and Ripatti,S.
Journal Nat. Genet. 44 (3), 269-276 (2012)
Title Human metabolic individuality in biomedical and pharmaceutical research .
Author Suhre,K., Shin,S.Y., Petersen,A.K., Mohney,R.P., Meredith,D., Wagele,B., Altmaier,E., Deloukas,P., Erdmann,J., Grundberg,E., Hammond,C.J., de Angelis,M.H., Kastenmuller,G., Kottgen,A., Kronenberg,F., Mangino,M., Meisinger,C., Meitinger,T., Mewes,H.W., Milburn,M.V., Prehn,C., Raffler,J., Ried,J.S., Romisch-Margl,W., Samani,N.J., Small,K.S., Wichmann,H.E., Zhai,G., Illig,T., Spector,T.D., Adamski,J., Soranzo,N. and Gieger,C.
Journal Nature 477 (7362), 54-60 (2011)
Title The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation .
Author Chan,S.Y., Martin-Santos,A., Loubiere,L.S., Gonzalez,A.M., Stieger,B., Logan,A., McCabe,C.J., Franklyn,J.A. and Kilby,M.D.
Journal J. Physiol. (Lond.) 589 (PT 11), 2827-2845 (2011)
Title Expression of thyroid hormone transporters in the human hypothalamus .
Author Alkemade,A., Friesema,E.C., Kalsbeek,A., Swaab,D.F., Visser,T.J. and Fliers,E.
Journal J. Clin. Endocrinol. Metab. 96 (6), E967-E971 (2011)
Title The thyroid hormone transporters MCT8 and MCT10 transport the affinity-label N-bromoacetyl-[(125)I]T3 but are not modified by it .
Author Visser,W.E., van Mullem,A.A., Jansen,J. and Visser,T.J.
Journal Mol. Cell. Endocrinol. 337 (1-2), 96-100 (2011)
Title Reabsorption of neutral amino acids mediated by amino acid transporter LAT2 and TAT1 in the basolateral membrane of proximal tubule .
Author Park,S.Y., Kim,J.K., Kim,I.J., Choi,B.K., Jung,K.Y., Lee,S., Park,K.J., Chairoungdua,A., Kanai,Y., Endou,H. and Kim,D.K.
Journal Arch. Pharm. Res. 28 (4), 421-432 (2005)
Title The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond .
Author Halestrap,A.P. and Meredith,D.
Journal Pflugers Arch. 447 (5), 619-628 (2004)
Title The human T-type amino acid transporter-1: characterization, gene organization, and chromosomal location .
Author Kim,D.K., Kanai,Y., Matsuo,H., Kim,J.Y., Chairoungdua,A., Kobayashi,Y., Enomoto,A., Cha,S.H., Goya,T. and Endou,H.
Journal Genomics 79 (1), 95-103 (2002)
Title Tat1, a novel sulfate transporter specifically expressed in human male germ cells and potentially linked to rhogtpase signaling .
Author Toure,A., Morin,L., Pineau,C., Becq,F., Dorseuil,O. and Gacon,G.
Journal J. Biol. Chem. 276 (23), 20309-20315 (2001)
Title Expression cloning of a Na+-independent aromatic amino acid transporter with structural similarity to H+/monocarboxylate transporters .
Author Kim,D.K., Kanai,Y., Chairoungdua,A., Matsuo,H., Cha,S.H. and Endou,H.
Journal J. Biol. Chem. 276 (20), 17221-17228 (2001)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.