• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu40613 Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu40613C Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), mRNA. Customized vector On-demand $269.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_018593.4, 221139821
Length 1548 bp
Structure linear
Update Date 02-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), mRNA.
Product monocarboxylate transporter 10
Comment

Summary: SLC16A10 is a member of a family of plasma membrane amino acid transporters that mediate the Na(+)-independent transport of aromatic amino acids across the plasma membrane.[supplied by OMIM, Apr 2004].

RefSeq NP_061063.2
CDS 176..1723
Misc Feature(1)125..127
Misc Feature(2)374..1636
Misc Feature(3)374..1636
Misc Feature(4)374..436
Misc Feature(5)386..1585
Misc Feature(6)order(428..430,437..442,452..454,458..463,527..529,
Misc Feature(7)518..580
Misc Feature(8)608..670
Misc Feature(9)689..751
Misc Feature(10)776..838
Misc Feature(11)860..922
Misc Feature(12)1049..1111
Misc Feature(13)1163..1225
Misc Feature(14)1229..1291
Misc Feature(15)1364..1426
Misc Feature(16)1433..1495
Misc Feature(17)1529..1591
Misc Feature(18)1667..1669
Exon (1)1..518
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (2)519..663
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (3)664..1117
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (4)1118..1261
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (5)1262..1490
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Exon (6)1491..2893
Gene:SLC16A10
Gene Synonym:MCT10; PRO0813; TAT1
Translation MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHE PPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSL SMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGC SFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIF MFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGI PLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVY LQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREI SKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+dbSNP:
52+a, gdbSNP:34764396
339+c, tdbSNP:370327858
418+a, cdbSNP:201455367
427+a, gdbSNP:145655903
457+c, tdbSNP:141109745
486+c, gdbSNP:145047809
491+a, gdbSNP:147581822
538+dbSNP:
538+c, tdbSNP:200765141
559+c, tdbSNP:142071847
574+c, tdbSNP:33965856
608+a, gdbSNP:372706701
614+a, gdbSNP:148349506
646+c, gdbSNP:140564027
649+c, gdbSNP:376225868
737+dbSNP:
737+c, tdbSNP:150478295
754+c, gdbSNP:138486397
765+a, gdbSNP:377728742
805+c, tdbSNP:116051634
896+a, cdbSNP:200192335
913+c, gdbSNP:142734633
930+a, gdbSNP:374208304
955+c, tdbSNP:377334109
973+c, tdbSNP:77208843
999+a, tdbSNP:370661991
1034+a, gdbSNP:116322832
1126+dbSNP:
1126+c, tdbSNP:149374548
1150+a, cdbSNP:373761089
1162+a, gdbSNP:188894873
1183+c, tdbSNP:181746758
1202+c, tdbSNP:202085593
1210+c, gdbSNP:113965591
1217+c, tdbSNP:200813678
1277+dbSNP:
1277+g, tdbSNP:201626230
1289+a, cdbSNP:148659008
1339+g, tdbSNP:371764487
1349+a, cdbSNP:374926181
1392+c, tdbSNP:200015784
1434+c, tdbSNP:142185010
1491+dbSNP:
1491+a, gdbSNP:369043875
1544+a, gdbSNP:115674232
1584+c, tdbSNP:375453220
1585+a, gdbSNP:373298002
1593+a, gdbSNP:114460402
1594+c, tdbSNP:147422659
1618+g, tdbSNP:377472794
1650+a, tdbSNP:183836560
1669+c, tdbSNP:370271933
1697+a, cdbSNP:17072442
1697+a, cdbSNP:386542218
1739+c, tdbSNP:373930541
1798+a, gdbSNP:118149501
1863+c, tdbSNP:189096229
1934+c, tdbSNP:368582525
1942..1943+, acdbSNP:201576847
1943..1944+, atdbSNP:148728349
1944..1945+, atdbSNP:34198423
1944..1945+, atdbSNP:72563616
1945..1946+, atdbSNP:34214262
1945+a, gdbSNP:201153583
1947+c, gdbSNP:199803669
2030+a, gdbSNP:10457235
2145+c, tdbSNP:73532731
2203+c, tdbSNP:375920655
2229+a, cdbSNP:14399
2452+c, tdbSNP:372870606
2573..2574+, aaac, caaadbSNP:151328273
2574..2575+, aaacdbSNP:66698226
2576..2577+, caaadbSNP:10680262
2700+c, tdbSNP:369772234
2833..2834+, tdbSNP:71838611
2868+a, gdbSNP:140163540
Gene SymbolSLC16A10
Gene SynonymMCT10; PRO0813; TAT1
Chromosome6
Locus Map6q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018593 Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), mRNA. On-demand TBD TBD
XM_005266818 PREDICTED: Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), transcript variant X1, mRNA. On-demand TBD TBD
XM_006715329 PREDICTED: Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), transcript variant X3, mRNA. On-demand TBD TBD
XM_005266819 PREDICTED: Homo sapiens solute carrier family 16 (aromatic amino acid transporter), member 10 (SLC16A10), transcript variant X2, mRNA. On-demand TBD TBD
Title Genome-wide association study identifies multiple loci influencing human serum metabolite levels .
Author Kettunen J, Tukiainen T, Sarin AP, Ortega-Alonso A, Tikkanen E, Lyytikainen LP, Kangas AJ, Soininen P, Wurtz P, Silander K, Dick DM, Rose RJ, Savolainen MJ, Viikari J, Kahonen M, Lehtimaki T, Pietilainen KH, Inouye M, McCarthy MI, Jula A, Eriksson J, Raitakari OT, Salomaa V, Kaprio J, Jarvelin MR, Peltonen L, Perola M, Freimer NB, Ala-Korpela M, Palotie A and Ripatti S.
Journal Nat. Genet. 44 (3), 269-276 (2012)
Title Human metabolic individuality in biomedical and pharmaceutical research .
Author Suhre K, Shin SY, Petersen AK, Mohney RP, Meredith D, Wagele B, Altmaier E, Deloukas P, Erdmann J, Grundberg E, Hammond CJ, de Angelis MH, Kastenmuller G, Kottgen A, Kronenberg F, Mangino M, Meisinger C, Meitinger T, Mewes HW, Milburn MV, Prehn C, Raffler J, Ried JS, Romisch-Margl W, Samani NJ, Small KS, Wichmann HE, Zhai G, Illig T, Spector TD, Adamski J, Soranzo N and Gieger C.
Journal Nature 477 (7362), 54-60 (2011)
Title The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation .
Author Chan SY, Martin-Santos A, Loubiere LS, Gonzalez AM, Stieger B, Logan A, McCabe CJ, Franklyn JA and Kilby MD.
Journal J. Physiol. (Lond.) 589 (PT 11), 2827-2845 (2011)
Title Expression of thyroid hormone transporters in the human hypothalamus .
Author Alkemade A, Friesema EC, Kalsbeek A, Swaab DF, Visser TJ and Fliers E.
Journal J. Clin. Endocrinol. Metab. 96 (6), E967-E971 (2011)
Title The thyroid hormone transporters MCT8 and MCT10 transport the affinity-label N-bromoacetyl-[(125)I]T3 but are not modified by it .
Author Visser WE, van Mullem AA, Jansen J and Visser TJ.
Journal Mol. Cell. Endocrinol. 337 (1-2), 96-100 (2011)
Title Reabsorption of neutral amino acids mediated by amino acid transporter LAT2 and TAT1 in the basolateral membrane of proximal tubule .
Author Park SY, Kim JK, Kim IJ, Choi BK, Jung KY, Lee S, Park KJ, Chairoungdua A, Kanai Y, Endou H and Kim DK.
Journal Arch. Pharm. Res. 28 (4), 421-432 (2005)
Title The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond .
Author Halestrap AP and Meredith D.
Journal Pflugers Arch. 447 (5), 619-628 (2004)
Title The human T-type amino acid transporter-1: characterization, gene organization, and chromosomal location .
Author Kim DK, Kanai Y, Matsuo H, Kim JY, Chairoungdua A, Kobayashi Y, Enomoto A, Cha SH, Goya T and Endou H.
Journal Genomics 79 (1), 95-103 (2002)
Title Tat1, a novel sulfate transporter specifically expressed in human male germ cells and potentially linked to rhogtpase signaling .
Author Toure A, Morin L, Pineau C, Becq F, Dorseuil O and Gacon G.
Journal J. Biol. Chem. 276 (23), 20309-20315 (2001)
Title Expression cloning of a Na+-independent aromatic amino acid transporter with structural similarity to H+/monocarboxylate transporters .
Author Kim DK, Kanai Y, Chairoungdua A, Matsuo H, Cha SH and Endou H.
Journal J. Biol. Chem. 276 (20), 17221-17228 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.