• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ethanolamine kinase 1 (ETNK1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_018638 Homo sapiens ethanolamine kinase 1 (ETNK1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 TBD

*Business Day

Related Services

RefSeq Version NM_018638.4, 87298841
Length 7101 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens ethanolamine kinase 1 (ETNK1), transcript variant 1, mRNA.
Product ethanolamine kinase 1 isoform A
Comment

Summary: This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (A).


##Evidence-Data-START## Transcript exon combination :: BC066907.1, AF207600.2 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_061108.2
CDS 23..1381
Misc Feature(1)434..1129
Misc Feature(2)434..1129
Misc Feature(3)437..1162
Misc Feature(4)order(452..454,458..460,464..469,473..475,515..517,
Misc Feature(5)order(452..454,467..469,473..475,515..517,521..523,
Misc Feature(6)order(458..460,464..466,950..952,956..958,965..967,
Misc Feature(7)order(560..562,569..574,581..586,614..625,749..751)
Exon (1)1..445
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Exon (2)446..705
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Exon (3)706..846
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Exon (4)847..989
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Exon (5)990..1073
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Exon (6)1074..1234
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Exon (7)1235..1308
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Exon (8)1309..7101
Gene:ETNK1
Gene Synonym:EKI; EKI 1; EKI1; Nbla10396
Translation MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGT EGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCRE GALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRD EEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAI HAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNL GSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYSLY PDRELQSQWLRAYLEAYKEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKY STIEFDFLGYAIVRFNQYFKMKPEVTALKVPE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
21+dbSNP:
21+a, gdbSNP:372875942
37+c, tdbSNP:376719028
40+a, gdbSNP:199647883
48+g, tdbSNP:201961217
70+c, gdbSNP:200778161
110+c, tdbSNP:150714252
180+c, tdbSNP:201229938
192+g, tdbSNP:202085804
229+c, tdbSNP:370044157
298+c, tdbSNP:75081525
342+a, gdbSNP:373330052
433+a, gdbSNP:114417438
478+dbSNP:
478+c, tdbSNP:200007670
487+c, tdbSNP:370696559
488+a, gdbSNP:150585672
553+c, tdbSNP:117802803
554+a, gdbSNP:147700944
613+a, gdbSNP:199816170
685+c, gdbSNP:201608129
688+c, tdbSNP:372778609
696+a, cdbSNP:201123814
753+dbSNP:
753+a, gdbSNP:370316713
773+a, gdbSNP:374315383
795+a, gdbSNP:190440442
836+a, gdbSNP:142416316
873+dbSNP:
873+a, gdbSNP:75025746
886+a, gdbSNP:4963793
886+c, tdbSNP:386486630
1034+dbSNP:
1034+c, tdbSNP:368251231
1133+dbSNP:
1133+c, tdbSNP:371547299
1156+a, tdbSNP:140394146
1188+, adbSNP:34032941
1196+a, gdbSNP:374176525
1214+c, gdbSNP:375707259
1302..1303+dbSNP:
1302..1303+, cdbSNP:35869773
1323+dbSNP:
1323+a, gdbSNP:150365004
complement(1355)-c, adbSNP:11548473
1372+a, gdbSNP:138041873
1378+g, tdbSNP:142528168
1391+g, tdbSNP:377113417
1408+c, gdbSNP:181367012
1424+c, gdbSNP:369665317
1459+g, tdbSNP:12316161
1461+g, tdbSNP:138515741
1575+c, tdbSNP:186999399
1602+a, gdbSNP:377529341
1754+a, cdbSNP:141163915
1791+c, gdbSNP:374911721
1794+a, gdbSNP:370988717
1804+, tdbSNP:34490298
1966+a, tdbSNP:191738259
2099+a, gdbSNP:184027698
2146+c, tdbSNP:375195492
2179..2182+, atcadbSNP:72185722
2249+g, tdbSNP:12317915
2529+a, tdbSNP:187364222
2579+a, gdbSNP:201147670
2683+a, cdbSNP:368140470
2857+c, tdbSNP:12312458
2861+a, gdbSNP:368508362
2964+a, cdbSNP:200138533
3011+a, tdbSNP:11046535
3072..3073+, cdbSNP:141532899
3074+a, gdbSNP:74068270
3178+c, tdbSNP:189725623
complement(3229)-t, cdbSNP:2129613
3278..3279+, tdbSNP:5796967
3305..3306+, ttdbSNP:3983448
3336+a, gdbSNP:372570437
3346+a, gdbSNP:11046536
complement(3351)-g, adbSNP:138002691
3387+a, gdbSNP:113726303
3391+c, tdbSNP:182376718
3477+g, tdbSNP:138138439
3484+g, tdbSNP:1048796
3585+a, gdbSNP:3741784
3638+c, tdbSNP:78491157
complement(3751)-c, adbSNP:149508913
3838+c, tdbSNP:186999182
4011+a, tdbSNP:191819215
4050+c, gdbSNP:596408
4092+c, tdbSNP:140515218
4117+c, tdbSNP:371733321
4237+c, tdbSNP:142855454
4288+a, gdbSNP:147436953
4309+c, tdbSNP:148713215
4348..4349+gg, ttdbSNP:386761153
4466+a, tdbSNP:183177623
4475+c, tdbSNP:188649483
4492+a, gdbSNP:142295135
4585+a, cdbSNP:16925296
4600+a, gdbSNP:118156699
4690+a, tdbSNP:1048797
4713+c, tdbSNP:192957454
4744+a, gdbSNP:374247340
4797+c, tdbSNP:73082506
4853+a, cdbSNP:73082509
4937+a, gdbSNP:185624904
4972..4973+, gdbSNP:35073632
4980+a, tdbSNP:11541361
4980+a, tdbSNP:386447219
complement(5047)-g, adbSNP:151273751
5056+a, gdbSNP:11046537
5140+g, tdbSNP:11046538
5157+a, tdbSNP:139282010
5174+g, tdbSNP:189378449
5181+a, gdbSNP:75654280
5194+a, tdbSNP:76167366
5229+g, tdbSNP:11046539
5237+g, tdbSNP:11046540
5248+a, gdbSNP:79556170
5309+g, tdbSNP:191164600
5338+c, tdbSNP:376715235
complement(5470)-g, adbSNP:144306539
5690..5691+, tadbSNP:146646684
5704+c, tdbSNP:369209435
complement(5767)-g, adbSNP:146597393
5857+a, cdbSNP:183624495
6052+a, gdbSNP:141362576
6271+a, gdbSNP:16925301
6477+a, gdbSNP:371266219
6500..6501+, tgdbSNP:200385491
6509+a, gdbSNP:373083641
6577+c, tdbSNP:188379423
6626+c, gdbSNP:181259203
6633..6634+, adbSNP:34050861
6677+c, gdbSNP:143246609
6700+a, cdbSNP:9435
6703+c, tdbSNP:369134827
7000+c, tdbSNP:115590851
Gene SymbolETNK1
Gene SynonymEKI; EKI 1; EKI1; Nbla10396
Chromosome12
Locus Map12p12.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018638 Homo sapiens ethanolamine kinase 1 (ETNK1), transcript variant 1, mRNA. In-stock $509.00 $460.00 TBD
NM_001039481 Homo sapiens ethanolamine kinase 1 (ETNK1), transcript variant 2, mRNA. On-demand TBD TBD
XM_005253420 PREDICTED: Homo sapiens ethanolamine kinase 1 (ETNK1), transcript variant X1, mRNA. On-demand TBD TBD
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud PJ, Drenos F, Shah S, Shah T, Palmen J, Verzilli C, Gaunt TR, Pallas J, Lovering R, Li K, Casas JP, Sofat R, Kumari M, Rodriguez S, Johnson T, Newhouse SJ, Dominiczak A, Samani NJ, Caulfield M, Sever P, Stanton A, Shields DC, Padmanabhan S, Melander O, Hastie C, Delles C, Ebrahim S, Marmot MG, Smith GD, Lawlor DA, Munroe PB, Day IN, Kivimaki M, Whittaker J, Humphries SE and Hingorani AD.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Coamplification of DAD-R, SOX5, and EKI1 in human testicular seminomas, with specific overexpression of DAD-R, correlates with reduced levels of apoptosis and earlier clinical manifestation .
Author Zafarana G, Gillis AJ, van Gurp RJ, Olsson PG, Elstrodt F, Stoop H, Millan JL, Oosterhuis JW and Looijenga LH.
Journal Cancer Res. 62 (6), 1822-1831 (2002)
Title Overexpression of a mammalian ethanolamine-specific kinase accelerates the CDP-ethanolamine pathway .
Author Lykidis A, Wang J, Karim MA and Jackowski S.
Journal J. Biol. Chem. 276 (3), 2174-2179 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.