• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens NOP10 ribonucleoprotein (NOP10), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19474 Homo sapiens NOP10 ribonucleoprotein (NOP10), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19474C Homo sapiens NOP10 ribonucleoprotein (NOP10), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_018648.3, 77812675
Length 195 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens NOP10 ribonucleoprotein (NOP10), mRNA.
Product H/ACA ribonucleoprotein complex subunit 3
Comment

Summary: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BU955288.1, AB043104.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_061118.1
CDS 89..283
Misc Feature(1)80..82
Misc Feature(2)95..247
Misc Feature(3)95..247
Misc Feature(4)194..196
Exon (1)1..142
Gene:NOP10
Gene Synonym:DKCB1; NOLA3; NOP10P
Exon (2)143..535
Gene:NOP10
Gene Synonym:DKCB1; NOLA3; NOP10P
Translation MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP RPVL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(51)-dbSNP:
complement(51)-g, adbSNP:112556317
complement(56)-t, cdbSNP:370148546
complement(59)-g, adbSNP:201270793
complement(70)-g, adbSNP:201920207
complement(75)-t, cdbSNP:373689981
complement(84)-g, adbSNP:181783900
complement(115)-t, cdbSNP:373678744
complement(119)-t, cdbSNP:370894572
complement(122)-g, cdbSNP:146261631
complement(163)-dbSNP:
complement(163)-t, adbSNP:368082745
complement(180)-t, gdbSNP:373843596
188+c, tdbSNP:121908092
complement(222)-c, adbSNP:201604296
complement(240)-t, cdbSNP:199661222
complement(285)-g, cdbSNP:371001053
complement(302)-t, adbSNP:201041278
complement(308)-g, adbSNP:377680031
complement(313..314)-gt, acdbSNP:386782889
313+a, gdbSNP:1045194
314+c, tdbSNP:1045204
complement(315)-g, adbSNP:370853886
complement(316)-g, adbSNP:375648407
complement(327)-t, cdbSNP:372176417
328+c, gdbSNP:1045238
complement(389)-g, adbSNP:146086719
complement(402)-g, adbSNP:3062
complement(412)-t, cdbSNP:115413508
complement(419)-t, g, adbSNP:3063
complement(432)-t, cdbSNP:7173
433+c, tdbSNP:12818
complement(437)-c, adbSNP:184964225
complement(440)-t, adbSNP:15117
complement(467)-t, c, adbSNP:113289404
complement(474)-g, adbSNP:78931560
Gene SymbolNOP10
Gene SynonymDKCB1; NOLA3; NOP10P
Chromosome15
Locus Map15q14-q15
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018648 Homo sapiens NOP10 ribonucleoprotein (NOP10), mRNA. In-stock $99.00 5-7
Title Effects of dyskeratosis congenita mutations in dyskerin, NHP2 and NOP10 on assembly of H/ACA pre-RNPs .
Author Trahan C, Martel C and Dragon F.
Journal Hum. Mol. Genet. 19 (5), 825-836 (2010)
Title Genetic heterogeneity in autosomal recessive dyskeratosis congenita with one subtype due to mutations in the telomerase-associated protein NOP10 .
Author Walne AJ, Vulliamy T, Marrone A, Beswick R, Kirwan M, Masunari Y, Al-Qurashi FH, Aljurf M and Dokal I.
Journal Hum. Mol. Genet. 16 (13), 1619-1629 (2007)
Title hNaf1 is required for accumulation of human box H/ACA snoRNPs, scaRNPs, and telomerase .
Author Hoareau-Aveilla C, Bonoli M, Caizergues-Ferrer M and Henry Y.
Journal RNA 12 (5), 832-840 (2006)
Title Mutations in TERT, the gene for telomerase reverse transcriptase, in aplastic anemia .
Author Yamaguchi H, Calado RT, Ly H, Kajigaya S, Baerlocher GM, Chanock SJ, Lansdorp PM and Young NS.
Journal N. Engl. J. Med. 352 (14), 1413-1424 (2005)
Title Nucleolar proteome dynamics .
Author Andersen JS, Lam YW, Leung AK, Ong SE, Lyon CE, Lamond AI and Mann M.
Journal Nature 433 (7021), 77-83 (2005)
Title Architecture and assembly of mammalian H/ACA small nucleolar and telomerase ribonucleoproteins .
Author Wang C and Meier UT.
Journal EMBO J. 23 (8), 1857-1867 (2004)
Title Human H/ACA small nucleolar RNPs and telomerase share evolutionarily conserved proteins NHP2 and NOP10 .
Author Pogacic V, Dragon F and Filipowicz W.
Journal Mol. Cell. Biol. 20 (23), 9028-9040 (2000)
Title Nhp2p and Nop10p are essential for the function of H/ACA snoRNPs .
Author Henras A, Henry Y, Bousquet-Antonelli C, Noaillac-Depeyre J, Gelugne JP and Caizergues-Ferrer M.
Journal EMBO J. 17 (23), 7078-7090 (1998)
Title Dyskeratosis Congenita .
Author Savage,S.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.