• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens PR domain containing 5 (PRDM5), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_018699 Homo sapiens PR domain containing 5 (PRDM5), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_018699.2, 41349475
Length 2492 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens PR domain containing 5 (PRDM5), mRNA.
Product PR domain zinc finger protein 5
Comment

Summary: The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. [provided by RefSeq, Jul 2008].

RefSeq NP_061169.2
CDS 251..2143
Misc Feature(1)206..208
Misc Feature(2)308..640
Misc Feature(3)308..640
Misc Feature(4)<683..1264
Misc Feature(5)1034..2113
Misc Feature(6)1253..1327
Misc Feature(7)1760..1831
Misc Feature(8)1844..1918
Misc Feature(9)1928..1999
Exon (1)1..343
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (2)344..427
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (3)428..550
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (4)551..725
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (5)726..900
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (6)901..993
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (7)994..1115
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (8)1116..1195
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (9)1196..1280
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (10)1281..1438
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (11)1439..1532
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (12)1533..1693
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (13)1694..1787
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (14)1788..1873
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (15)1874..1978
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (16)1979..2480
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Translation MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEV RGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQEGENIFYLAVEDIETDTELL IGYLDSDMEAEEEEQQIMTVIKEGEVENSRRQSTAGRKDRLGCKEDYACPQCESSFTSED ILAEHLQTLHQKPTEEKEFKCKNCGKKFPVKQALQRHVLQCTAKSSLKESSRSFQCSVCN SSFSSASSFEQHQETCRGDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVC NKKCSSASSLQEHRKIHEIFDCQECMKKFISANQLKRHMITHSEKRPYNCEICNKSFKRL DQVGAHKVIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQ RHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHK KTHTGEKEKICPYCGQKFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMHIRTHT REKPYKCSECSKAFSQKRGLDEHKRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRP LAECQFCHKKFTRNDYLKVHMDNIHGVADS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(17)-dbSNP:
complement(17)-g, adbSNP:111704622
complement(26)-t, adbSNP:193118534
complement(72)-g, cdbSNP:188478897
complement(247)-t, cdbSNP:13105363
complement(292)-g, cdbSNP:141699988
complement(307)-g, cdbSNP:148449361
complement(414)-dbSNP:
complement(414)-g, cdbSNP:147410661
complement(431)-dbSNP:
complement(431)-g, adbSNP:142855444
complement(457)-g, adbSNP:189799619
complement(486)-g, cdbSNP:201325904
complement(498)-t, cdbSNP:201945549
complement(528)-t, cdbSNP:138935597
complement(532)-t, cdbSNP:201700872
complement(592)-dbSNP:
complement(592)-t, gdbSNP:146228268
complement(741)-dbSNP:
complement(741)-t, adbSNP:146268537
complement(743)-t, cdbSNP:149561340
complement(794)-g, adbSNP:199602365
complement(808)-g, cdbSNP:200556342
complement(832)-t, cdbSNP:201752403
complement(877)-t, cdbSNP:138170787
complement(894)-t, cdbSNP:150423808
complement(910)-dbSNP:
complement(910)-t, cdbSNP:74320998
complement(931)-g, adbSNP:343192
complement(934)-g, cdbSNP:199527174
complement(955)-g, cdbSNP:145114094
complement(990)-g, adbSNP:187637689
complement(996)-dbSNP:
complement(996)-g, adbSNP:77040785
complement(1000)-t, cdbSNP:141378225
complement(1019)-g, adbSNP:190835070
complement(1026)-t, adbSNP:200275445
complement(1028)-t, cdbSNP:146635067
complement(1037)-c, adbSNP:201226534
complement(1062)-t, cdbSNP:144553125
complement(1089)-t, cdbSNP:183142477
complement(1099)-t, cdbSNP:17051264
complement(1117)-dbSNP:
complement(1117)-t, cdbSNP:144906959
complement(1148)-c, adbSNP:149897360
complement(1160)-g, adbSNP:192586435
complement(1171)-t, cdbSNP:190061397
complement(1174)-t, cdbSNP:146673397
complement(1205)-dbSNP:
complement(1205)-t, cdbSNP:139100729
complement(1213)-t, cdbSNP:34666716
complement(1225)-g, adbSNP:202190463
complement(1259)-g, adbSNP:142805564
complement(1260)-g, cdbSNP:140554156
complement(1282)-dbSNP:
complement(1282)-t, cdbSNP:200926648
complement(1316)-t, adbSNP:140634372
complement(1322)-t, cdbSNP:141803942
complement(1363)-t, gdbSNP:148079992
complement(1398)-t, cdbSNP:144688467
complement(1421)-g, adbSNP:149367073
complement(1484)-dbSNP:
complement(1484)-g, adbSNP:12499000
complement(1523)-t, cdbSNP:75893420
complement(1589)-dbSNP:
complement(1589)-t, adbSNP:193201534
complement(1633)-g, adbSNP:55774575
complement(1777)-dbSNP:
complement(1777)-c, adbSNP:181473034
complement(1825)-dbSNP:
complement(1825)-t, cdbSNP:138442036
complement(1855)-g, adbSNP:150476884
complement(1863)-g, adbSNP:140622920
complement(1879)-dbSNP:
complement(1879)-t, cdbSNP:200669512
complement(1882)-t, cdbSNP:116026637
complement(1883)-g, adbSNP:142515463
complement(1891)-g, adbSNP:148837515
complement(1963)-t, cdbSNP:184132410
complement(1969)-g, adbSNP:62323059
complement(1972)-t, cdbSNP:147796327
complement(2119)-dbSNP:
complement(2119)-g, adbSNP:200986766
complement(2166)-g, adbSNP:111665249
complement(2193)-g, adbSNP:185351209
complement(2214)-g, adbSNP:150300961
complement(2263)-g, adbSNP:77157999
complement(2297)-t, adbSNP:181244989
Gene SymbolPRDM5
Gene SynonymBCS2; PFM2
Chromosome4
Locus Map4q25-q26
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018699 Homo sapiens PR domain containing 5 (PRDM5), mRNA. On-demand $849.00 20
Title Mutations in PRDM5 in brittle cornea syndrome identify a pathway regulating extracellular matrix development and maintenance .
Author Burkitt Wright,E.M., Spencer,H.L., Daly,S.B., Manson,F.D., Zeef,L.A., Urquhart,J., Zoppi,N., Bonshek,R., Tosounidis,I., Mohan,M., Madden,C., Dodds,A., Chandler,K.E., Banka,S., Au,L., Clayton-Smith,J., Khan,N., Biesecker,L.G., Wilson,M., Rohrbach,M., Colombi,M., Giunta,C. and Black,G.C.
Journal Am. J. Hum. Genet. 88 (6), 767-777 (2011)
Title Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients .
Author Bhatnagar,P., Purvis,S., Barron-Casella,E., DeBaun,M.R., Casella,J.F., Arking,D.E. and Keefer,J.R.
Journal J. Hum. Genet. 56 (4), 316-323 (2011)
Title The epigenetic modifier PRDM5 functions as a tumor suppressor through modulating WNT/beta-catenin signaling and is frequently silenced in multiple tumors .
Author Shu,X.S., Geng,H., Li,L., Ying,J., Ma,C., Wang,Y., Poon,F.F., Wang,X., Ying,Y., Yeo,W., Srivastava,G., Tsao,S.W., Yu,J., Sung,J.J., Huang,S., Chan,A.T. and Tao,Q.
Journal PLoS ONE 6 (11), E27346 (2011)
Title DNA methylation and carcinogenesis of PRDM5 in cervical cancer .
Author Cheng,H.Y., Chen,X.W., Cheng,L., Liu,Y.D. and Lou,G.
Journal J. Cancer Res. Clin. Oncol. 136 (12), 1821-1825 (2010)
Title A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts .
Author Kalsi,G., Kuo,P.H., Aliev,F., Alexander,J., McMichael,O., Patterson,D.G., Walsh,D., Zhao,Z., Schuckit,M., Nurnberger,J. Jr., Edenberg,H., Kramer,J., Hesselbrock,V., Tischfield,J.A., Vladimirov,V., Prescott,C.A., Dick,D.M., Kendler,K.S. and Riley,B.P.
Journal Hum. Mol. Genet. 19 (12), 2497-2506 (2010)
Title Epigenetic regulation of protein-coding and microRNA genes by the Gfi1-interacting tumor suppressor PRDM5 .
Author Duan,Z., Person,R.E., Lee,H.H., Huang,S., Donadieu,J., Badolato,R., Grimes,H.L., Papayannopoulou,T. and Horwitz,M.S.
Journal Mol. Cell. Biol. 27 (19), 6889-6902 (2007)
Title PRDM5 identified as a target of epigenetic silencing in colorectal and gastric cancer .
Author Watanabe,Y., Toyota,M., Kondo,Y., Suzuki,H., Imai,T., Ohe-Toyota,M., Maruyama,R., Nojima,M., Sasaki,Y., Sekido,Y., Hiratsuka,H., Shinomura,Y., Imai,K., Itoh,F. and Tokino,T.
Journal Clin. Cancer Res. 13 (16), 4786-4794 (2007)
Title PRDM5 is silenced in human cancers and has growth suppressive activities .
Author Deng,Q. and Huang,S.
Journal Oncogene 23 (28), 4903-4910 (2004)
Title SET domains and histone methylation .
Author Xiao,B., Wilson,J.R. and Gamblin,S.J.
Journal Curr. Opin. Struct. Biol. 13 (6), 699-705 (2003)
Title The yin-yang of PR-domain family genes in tumorigenesis .
Author Jiang,G.L. and Huang,S.
Journal Histol. Histopathol. 15 (1), 109-117 (2000)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.