• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens PR domain containing 5 (PRDM5), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_018699 Homo sapiens PR domain containing 5 (PRDM5), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_018699.2, 41349475
Length 2492 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens PR domain containing 5 (PRDM5), mRNA.
Product PR domain zinc finger protein 5
Comment

Summary: The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. [provided by RefSeq, Jul 2008].

RefSeq NP_061169.2
CDS 251..2143
Misc Feature(1)206..208
Misc Feature(2)308..640
Misc Feature(3)308..640
Misc Feature(4)1034..2110
Misc Feature(5)1253..1327
Misc Feature(6)1760..1831
Misc Feature(7)1844..1918
Misc Feature(8)1928..1999
Exon (1)1..343
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (2)344..427
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (3)428..550
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (4)551..725
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (5)726..900
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (6)901..993
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (7)994..1115
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (8)1116..1195
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (9)1196..1280
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (10)1281..1438
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (11)1439..1532
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (12)1533..1693
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (13)1694..1787
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (14)1788..1873
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (15)1874..1978
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Exon (16)1979..2480
Gene:PRDM5
Gene Synonym:BCS2; PFM2
Translation MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEV RGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQEGENIFYLAVEDIETDTELL IGYLDSDMEAEEEEQQIMTVIKEGEVENSRRQSTAGRKDRLGCKEDYACPQCESSFTSED ILAEHLQTLHQKPTEEKEFKCKNCGKKFPVKQALQRHVLQCTAKSSLKESSRSFQCSVCN SSFSSASSFEQHQETCRGDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVC NKKCSSASSLQEHRKIHEIFDCQECMKKFISANQLKRHMITHSEKRPYNCEICNKSFKRL DQVGAHKVIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQ RHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHK KTHTGEKEKICPYCGQKFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMHIRTHT REKPYKCSECSKAFSQKRGLDEHKRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRP LAECQFCHKKFTRNDYLKVHMDNIHGVADS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(17)-dbSNP:
complement(17)-g, adbSNP:111704622
complement(26)-t, adbSNP:193118534
complement(72)-g, cdbSNP:188478897
complement(216)-g, adbSNP:370386527
complement(247)-t, cdbSNP:13105363
complement(292)-g, cdbSNP:141699988
complement(296)-t, gdbSNP:377348597
complement(307)-g, cdbSNP:148449361
complement(329)-g, adbSNP:373822101
complement(356)-dbSNP:
complement(356)-t, cdbSNP:374583073
complement(381)-g, adbSNP:370047823
complement(413)-t, adbSNP:374003643
complement(414)-g, cdbSNP:147410661
complement(431)-dbSNP:
complement(431)-g, adbSNP:142855444
complement(457)-g, adbSNP:189799619
complement(458)-t, cdbSNP:369843425
complement(486)-g, cdbSNP:201325904
complement(487)-g, adbSNP:374500219
complement(498)-t, cdbSNP:201945549
complement(528)-t, cdbSNP:138935597
complement(532)-t, cdbSNP:201700872
complement(567)-dbSNP:
complement(567)-t, adbSNP:372366236
570+a, gdbSNP:387907111
complement(592)-t, gdbSNP:146228268
complement(684)-t, adbSNP:367672112
complement(703)-t, adbSNP:373828468
complement(706)-t, cdbSNP:370659691
complement(741)-dbSNP:
complement(741)-t, adbSNP:146268537
complement(757)-g, adbSNP:377651204
complement(761)-t, gdbSNP:370082902
complement(794)-g, adbSNP:199602365
complement(802)-t, cdbSNP:373372578
complement(808)-g, cdbSNP:200556342
complement(832)-t, cdbSNP:201752403
complement(877)-t, cdbSNP:138170787
complement(894)-t, cdbSNP:150423808
complement(910)-dbSNP:
complement(910)-t, cdbSNP:74320998
931+a, gdbSNP:343192
complement(934)-g, cdbSNP:199527174
complement(955)-g, cdbSNP:145114094
complement(976)-g, adbSNP:372141288
complement(990)-g, adbSNP:187637689
complement(996)-dbSNP:
complement(996)-g, adbSNP:77040785
complement(1000)-t, cdbSNP:141378225
complement(1001)-g, adbSNP:371288295
complement(1019)-g, adbSNP:190835070
complement(1026)-t, adbSNP:200275445
complement(1028)-t, cdbSNP:146635067
complement(1037)-c, adbSNP:201226534
complement(1062)-t, cdbSNP:144553125
complement(1089)-t, cdbSNP:183142477
complement(1092)-c, adbSNP:373835306
complement(1099)-t, cdbSNP:17051264
complement(1117)-dbSNP:
complement(1117)-t, cdbSNP:144906959
complement(1152)-t, cdbSNP:370083936
complement(1160)-g, adbSNP:192586435
complement(1171)-t, cdbSNP:190061397
complement(1174)-t, cdbSNP:146673397
complement(1205)-dbSNP:
complement(1205)-t, cdbSNP:139100729
1213+c, tdbSNP:34666716
complement(1225)-g, adbSNP:202190463
complement(1259)-g, adbSNP:142805564
complement(1260)-t, cdbSNP:140554156
complement(1282)-dbSNP:
complement(1282)-t, cdbSNP:200926648
complement(1312)-c, adbSNP:373047004
complement(1316)-t, adbSNP:140634372
complement(1363)-t, gdbSNP:148079992
complement(1364)-t, cdbSNP:369580755
complement(1421)-g, adbSNP:149367073
complement(1437)-t, gdbSNP:376508533
complement(1462)-dbSNP:
complement(1462)-g, cdbSNP:375961361
complement(1484)-g, adbSNP:12499000
complement(1490)-g, adbSNP:371659094
complement(1523)-t, cdbSNP:75893420
complement(1582)-dbSNP:
complement(1582)-g, cdbSNP:368307888
complement(1589)-t, adbSNP:193201534
complement(1600)-g, adbSNP:373651708
complement(1603)-g, adbSNP:374433951
complement(1629)-t, cdbSNP:371617787
complement(1633)-g, adbSNP:55774575
complement(1757)-dbSNP:
complement(1757)-t, adbSNP:373140800
complement(1777)-c, adbSNP:181473034
complement(1825)-dbSNP:
complement(1825)-t, cdbSNP:138442036
complement(1855)-g, adbSNP:150476884
complement(1863)-g, adbSNP:140622920
complement(1870)-g, adbSNP:375097361
complement(1879)-dbSNP:
complement(1879)-t, cdbSNP:200669512
complement(1882)-t, cdbSNP:116026637
complement(1883)-g, adbSNP:142515463
complement(1891)-g, adbSNP:148837515
complement(1894)-t, adbSNP:374866663
complement(1947)-g, adbSNP:371714829
complement(1963)-t, cdbSNP:184132410
complement(1969)-g, adbSNP:62323059
complement(1972)-t, cdbSNP:147796327
2018+dbSNP:
2018+c, tdbSNP:387907110
complement(2106)-c, adbSNP:368866083
complement(2119)-g, adbSNP:200986766
complement(2137)-g, adbSNP:376740879
complement(2166)-g, adbSNP:111665249
complement(2182)-g, cdbSNP:372073196
complement(2193)-g, adbSNP:185351209
complement(2214)-g, adbSNP:150300961
complement(2263)-g, adbSNP:77157999
complement(2297)-t, adbSNP:181244989
complement(2464)-g, adbSNP:371548150
Gene SymbolPRDM5
Gene SynonymBCS2; PFM2
Chromosome4
Locus Map4q25-q26
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018699 Homo sapiens PR domain containing 5 (PRDM5), mRNA. On-demand $849.00 20
XM_005262706 PREDICTED: Homo sapiens PR domain containing 5 (PRDM5), transcript variant X1, mRNA. On-demand $849.00 20
XM_006714072 PREDICTED: Homo sapiens PR domain containing 5 (PRDM5), transcript variant X4, mRNA. On-demand $699.00 18
XM_005262707 PREDICTED: Homo sapiens PR domain containing 5 (PRDM5), transcript variant X2, mRNA. On-demand $699.00 18
XM_005262708 PREDICTED: Homo sapiens PR domain containing 5 (PRDM5), transcript variant X3, mRNA. On-demand $549.00 14
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title Mutations in PRDM5 in brittle cornea syndrome identify a pathway regulating extracellular matrix development and maintenance .
Author Burkitt Wright EM, Spencer HL, Daly SB, Manson FD, Zeef LA, Urquhart J, Zoppi N, Bonshek R, Tosounidis I, Mohan M, Madden C, Dodds A, Chandler KE, Banka S, Au L, Clayton-Smith J, Khan N, Biesecker LG, Wilson M, Rohrbach M, Colombi M, Giunta C and Black GC.
Journal Am. J. Hum. Genet. 88 (6), 767-777 (2011)
Title Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients .
Author Bhatnagar P, Purvis S, Barron-Casella E, DeBaun MR, Casella JF, Arking DE and Keefer JR.
Journal J. Hum. Genet. 56 (4), 316-323 (2011)
Title The epigenetic modifier PRDM5 functions as a tumor suppressor through modulating WNT/beta-catenin signaling and is frequently silenced in multiple tumors .
Author Shu XS, Geng H, Li L, Ying J, Ma C, Wang Y, Poon FF, Wang X, Ying Y, Yeo W, Srivastava G, Tsao SW, Yu J, Sung JJ, Huang S, Chan AT and Tao Q.
Journal PLoS ONE 6 (11), E27346 (2011)
Title A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts .
Author Kalsi G, Kuo PH, Aliev F, Alexander J, McMichael O, Patterson DG, Walsh D, Zhao Z, Schuckit M, Nurnberger J Jr, Edenberg H, Kramer J, Hesselbrock V, Tischfield JA, Vladimirov V, Prescott CA, Dick DM, Kendler KS and Riley BP.
Journal Hum. Mol. Genet. 19 (12), 2497-2506 (2010)
Title Epigenetic regulation of protein-coding and microRNA genes by the Gfi1-interacting tumor suppressor PRDM5 .
Author Duan Z, Person RE, Lee HH, Huang S, Donadieu J, Badolato R, Grimes HL, Papayannopoulou T and Horwitz MS.
Journal Mol. Cell. Biol. 27 (19), 6889-6902 (2007)
Title PRDM5 identified as a target of epigenetic silencing in colorectal and gastric cancer .
Author Watanabe Y, Toyota M, Kondo Y, Suzuki H, Imai T, Ohe-Toyota M, Maruyama R, Nojima M, Sasaki Y, Sekido Y, Hiratsuka H, Shinomura Y, Imai K, Itoh F and Tokino T.
Journal Clin. Cancer Res. 13 (16), 4786-4794 (2007)
Title PRDM5 is silenced in human cancers and has growth suppressive activities .
Author Deng Q and Huang S.
Journal Oncogene 23 (28), 4903-4910 (2004)
Title SET domains and histone methylation .
Author Xiao B, Wilson JR and Gamblin SJ.
Journal Curr. Opin. Struct. Biol. 13 (6), 699-705 (2003)
Title The yin-yang of PR-domain family genes in tumorigenesis .
Author Jiang GL and Huang S.
Journal Histol. Histopathol. 15 (1), 109-117 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.